Calpain 11 Antibody (2G2) - Azide and BSA Free

Sandwich ELISA: Calpain 11 Antibody (2G2) [H00011131-M04] - Detection limit for recombinant GST tagged CAPN11 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 2G2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Calpain 11 Antibody (2G2) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Calpain 11 Antibody (2G2) - Azide and BSA Free (H00011131-M04) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CAPN11 (NP_008989, 557 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLNRMAIKFKSFKTKGFGLDACRCMINLMDKDGSGKLGLLEFKILWKKLKKWMDIFRECDQDHSGTLNSYEMRLVIEKAGIKLNNKVMQVLVARY
• Specificity: CAPN11 - calpain 11 (2G2)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CAPN11
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: This product is useful for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Calpain 11 Antibody (2G2) - Azide and BSA Free

• Calcium-activated neutral proteinase 11
• calpain 11
• calpain11
• calpain-11
• CANP 11
• EC 3.4.22
• EC 3.4.22.-
• EC 3.4.22.52
• EC 3.4.22.54

Background

Calpains constitute a family of intracellular calcium-dependent cysteine proteases. There are eight members in this superfamily. They consist of a variable 80 kDa subunit and an invariant 30 kDa subunit. Calpain 11 protein represents a distinct calpain subfamily. While its exact function is not known, it may have a protease activity and calcium-binding ability. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAPN11
• Entrez:
  • 11131(Human)
• Uniprot:
  • NP_008989(Human)