Calpain 9 Antibody (3A6) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse Calpain 9 Antibody (3A6) - Azide and BSA Free (H00010753-M02) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-Calpain 9 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
CAPN9 (NP_006606, 591 a.a. ~ 690 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNINEFIHLTMNI |
| Specificity |
CAPN9 - calpain 9 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
CAPN9 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin 1 ug/ml
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Calpain 9 Antibody (3A6) - Azide and BSA Free
Background
Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is expressed predominantly in stomach and small intestine and may have specialized functions in the digestive tract. This gene is thought to be associated with gastric cancer. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Publications for Calpain 9 Antibody (H00010753-M02)(5)
Showing Publications 1 -
5 of 5.
| Publications using H00010753-M02 |
Applications |
Species |
| Kim D, Beckett J, Nagpal V et al. Calpain 9 as a therapeutic target in TGF?-induced mesenchymal transition and fibrosis. Sci Transl Med. 2019-07-17 [PMID: 31316008] |
|
|
| Davis J, Martin SG, Patel PM et al. Low calpain-9 is associated with adverse disease-specific survival following endocrine therapy in breast cancer. BMC Cancer. 2014-12-23 [PMID: 25539577] |
|
|
| Storr SJ, Pu X, Davis J et al. Expression of the calpain system is associated with poor clinical outcome in gastro-oesophageal adenocarcinomas. J Gastroenterol. 2013-01-19 [PMID: 23329366] |
|
|
| Hata S, Abe M, Suzuki H et al. Calpain 8/nCL-2 and Calpain 9/nCL-4 Constitute an Active Protease Complex, G-Calpain, Involved in Gastric Mucosal Defense. PLoS Genet. 2010-07-29 [PMID: 20686710] |
|
|
| Chen CJ, Nguyen T, Shively JE. Role of calpain-9 and PKC-delta in the apoptotic mechanism of lumen formation in CEACAM1 transfected breast epithelial cells. Exp Cell Res. 2009-11-01 [PMID: 19909740] |
|
|
Reviews for Calpain 9 Antibody (H00010753-M02) (0)
There are no reviews for Calpain 9 Antibody (H00010753-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Calpain 9 Antibody (H00010753-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Calpain 9 Products
Research Areas for Calpain 9 Antibody (H00010753-M02)
Find related products by research area.
|
Blogs on Calpain 9