Calpain 9 Antibody (3A6)

Images

 
Western Blot: Calpain 9 Antibody (3A6) [H00010753-M02] - CAPN9 monoclonal antibody (M02), clone 3A6. Analysis of CAPN9 expression in human colon.
Immunohistochemistry-Paraffin: Calpain 9 Antibody (3A6) [H00010753-M02] - Analysis of monoclonal antibody to CAPN9 on formalin-fixed paraffin-embedded human liver. Antibody concentration 1 ug/ml.
ELISA: Calpain 9 Antibody (3A6) [H00010753-M02] - Detection limit for recombinant GST tagged CAPN9 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
3A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Calpain 9 Antibody (3A6) Summary

Immunogen
CAPN9 (NP_006606, 591 a.a. ~ 690 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNINEFIHLTMNI
Specificity
CAPN9 - calpain 9
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CAPN9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1 ug/ml
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publications using H00010753-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Calpain 9 Antibody (3A6)

  • calpain 9 (nCL-4)
  • calpain 9
  • calpain-9
  • Digestive tract-specific calpain
  • EC 3.4.22
  • EC 3.4.22.54
  • GC36
  • NCL4
  • nCL-4EC 3.4.22.-
  • New calpain 4
  • novel calpain large subunit-4
  • Protein CG36

Background

Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is expressed predominantly in stomach and small intestine and may have specialized functions in the digestive tract. This gene is thought to be associated with gastric cancer. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01819
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-15671
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF6480
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-56622
Species: Hu
Applications: ICC/IF
NBP2-15671
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31756
Species: Hu
Applications: ICC/IF, WB
H00056287-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-31756
Species: Hu
Applications: ICC/IF, WB
NBL1-08611
Species: Hu
Applications: WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
H00092291-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-88204
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47668
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-15937
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calpain 9 Antibody (H00010753-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calpain 9 Products

Bioinformatics Tool for Calpain 9 Antibody (H00010753-M02)

Discover related pathways, diseases and genes to Calpain 9 Antibody (H00010753-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calpain 9 Antibody (H00010753-M02)

Discover more about diseases related to Calpain 9 Antibody (H00010753-M02).
 

Pathways for Calpain 9 Antibody (H00010753-M02)

View related products by pathway.

PTMs for Calpain 9 Antibody (H00010753-M02)

Learn more about PTMs related to Calpain 9 Antibody (H00010753-M02).
 

Research Areas for Calpain 9 Antibody (H00010753-M02)

Find related products by research area.

Blogs on Calpain 9

There are no specific blogs for Calpain 9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calpain 9 Antibody (3A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPN9
Entrez
OMIM
Uniprot