calmodulin-lysine N-methyltransferase Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit calmodulin-lysine N-methyltransferase Antibody - BSA Free (NBP2-82975) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human calmodulin-lysine N-methyltransferase. Peptide sequence: QFCNLAEKAGFCIQRHENYDEHISNFHSKLKKENPDIYEENLHYPLLLIL The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CAMKMT |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for calmodulin-lysine N-methyltransferase Antibody - BSA Free
Background
Isoform 1 is expressed in brain,liver, muscle colon and lung. Isoform 2 is expressed in colon,testis, kidney and brain. Isoform 1 and isoform 2 are expressed in normal lymphoblastoid cells but not inlymphoblastoid cells from patients with hypotonia-cystinuria syndrome
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu, Mu
Applications: IHC
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for calmodulin-lysine N-methyltransferase Antibody (NBP2-82975) (0)
There are no publications for calmodulin-lysine N-methyltransferase Antibody (NBP2-82975).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for calmodulin-lysine N-methyltransferase Antibody (NBP2-82975) (0)
There are no reviews for calmodulin-lysine N-methyltransferase Antibody (NBP2-82975).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for calmodulin-lysine N-methyltransferase Antibody (NBP2-82975) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional calmodulin-lysine N-methyltransferase Products
Blogs on calmodulin-lysine N-methyltransferase