![Western Blot: CALML6 Antibody [H00163688-D01P] - Analysis of CALML6 expression in transfected 293T cell line by CALML6 polyclonal antibody.Lane 1: CALML6 transfected lysate(19.91 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize2/CALML6-Antibody-Western-Blot-H00163688-D01P-img0003.jpg "Western Blot: CALML6 Antibody [H00163688-D01P] - Analysis of CALML6 expression in transfected 293T cell line by CALML6 polyclonal antibody.Lane 1: CALML6 transfected lysate(19.91 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | CALML6 (AAI60060.1, 1 a.a. - 181 a.a.) full-length human protein. MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPTKSELASMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLIQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CALML6 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is useful for Western Blot |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
-Immunocytochemistry-Immunofluorescence-NB120-2860-img0015.jpg)
-Immunocytochemistry-Immunofluorescence-NB120-2860-img0016.jpg)
-Immunocytochemistry-Immunofluorescence-NB120-2860-img0017.jpg)
-Immunocytochemistry-Immunofluorescence-H00030818-M01-img0004.jpg)
-Immunoprecipitation-H00030818-M01-img0005.jpg)
-Western-Blot-H00030818-M01-img0007.jpg)
---Azide-and-BSA-Free-Protein-Array-NBP2-79899-img0001.jpg)
---Azide-and-BSA-Free-Immunocytochemistry-Immunofluorescence-NBP2-79899-img0002.jpg)
---Azide-and-BSA-Free-Immunohistochemistry-Paraffin-NBP2-79899-img0003.jpg)
-Antibody-Immunohistochemistry-Paraffin-NBP2-37958-img0002.jpg)
-Antibody-Immunohistochemistry-Paraffin-NBP2-37958-img0003.jpg)
-Antibody-Immunohistochemistry-Paraffin-NBP2-37958-img0004.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CALML6 Antibody (H00163688-D01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CALML6 |
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: CALML6 Antibody [H00163688-D01P] - Analysis of antibody to CALML6 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize2/CALML6-Antibody-Immunocytochemistry-Immunofluorescence-H00163688-D01P-img0002.jpg "Immunocytochemistry/Immunofluorescence: CALML6 Antibody [H00163688-D01P] - Analysis of antibody to CALML6 on HeLa cell. Antibody concentration 10 ug/ml.")
-Flow-Cytometry-NBP2-45267-img0016.jpg)
-Flow-Cytometry-NBP2-45267-img0010.jpg)
-Immunocytochemistry-Immunofluorescence-NBP2-45267-img0011.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")