Recombinant Human Calcitonin R Protein

Images

 
SDS-Page: Recombinant Human Calcitonin R Protein [H00000799-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Calcitonin R Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-81 of Human CALCR partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CALCR

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Calcitonin R Protein

  • Calcitonin R
  • calcitonin receptor
  • CalcitoninR
  • CALCR
  • CRT
  • CTR
  • CT-R
  • CTR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NB100-402
Species: Hu, Mu, Rt, Po, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NLS6731
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for Calcitonin R Partial Recombinant Protein (H00000799-Q01) (0)

There are no publications for Calcitonin R Partial Recombinant Protein (H00000799-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calcitonin R Partial Recombinant Protein (H00000799-Q01) (0)

There are no reviews for Calcitonin R Partial Recombinant Protein (H00000799-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calcitonin R Partial Recombinant Protein (H00000799-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Calcitonin R Products

Bioinformatics Tool for Calcitonin R Partial Recombinant Protein (H00000799-Q01)

Discover related pathways, diseases and genes to Calcitonin R Partial Recombinant Protein (H00000799-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calcitonin R Partial Recombinant Protein (H00000799-Q01)

Discover more about diseases related to Calcitonin R Partial Recombinant Protein (H00000799-Q01).
 

Pathways for Calcitonin R Partial Recombinant Protein (H00000799-Q01)

View related products by pathway.

Research Areas for Calcitonin R Partial Recombinant Protein (H00000799-Q01)

Find related products by research area.

Blogs on Calcitonin R

There are no specific blogs for Calcitonin R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRANCE/TNFSF11/RANK L
462-TR-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Calcitonin R Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CALCR
Entrez