Calcitonin R Antibody (2F7)

Sandwich ELISA: Calcitonin R Antibody (2F7) [H00000799-M01] - Detection limit for recombinant GST tagged CALCR is approximately 0.03ng/ml as a capture antibody.

Product Discontinued

Calcitonin R Antibody (2F7) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CALCR (NP_001733.1, 394 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA
• Specificity: CALCR - calcitonin receptor (2F7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CALCR
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Calcitonin R Antibody (2F7)

• Calcitonin R
• calcitonin receptor
• CalcitoninR
• CALCR
• CRT
• CTR
• CT-R
• CTR1

Background

The Calcitonin Receptor inhibits bone resorption. This receptor is expressed during development and is involved in morphogenesis. Three alternatively spliced Calcitonin Receptor isoforms have been identified. In addition to binding calcitonin, the Calcitonin Receptor can complex with RAMP3 (receptor activity modifying protein) to bind amylin, which regulates pancreatic islet function and is involved in Type II diabetes. The Calcitonin Receptor has been reported in artery, blood, bone, brain, kidney, lung, placenta, prostate, skeletal muscle, and thyroid. ESTs have been isolated from bone, embryo, kidney, and melanocyte/uterus/fetal heart libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Calcitonin R Antibody (H00000799-M01)(1)

Publication using H00000799-M01

• Segovia-Silvestre T, Bonnefond C, Sondergaard BC et al. Identification of the calcitonin receptor in osteoarthritic chondrocytes. BMC Res Notes. 2011-10-13 [PMID: 21996094]

Bioinformatics

• Gene Symbol: CALCR
• Entrez:
  • 799(Human)
• Uniprot:
  • NP_001733()