Calcineurin B Antibody - BSA Free

Western Blot: Calcineurin B Antibody [NBP1-56816] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Calcineurin B Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PPP3R1(protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform) The peptide sequence was selected from the N terminal of PPP3R1. Peptide sequence MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: B type 1.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP3R1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Calcineurin B Antibody - BSA Free

• Calcineurin B
• calcineurin subunit B type 1
• CALNB1
• CNA2
• Cnb1
• MCIP1
• PP2B beta 1
• PPP3R1
• Protein phosphatase 2B regulatory subunit 1
• protein phosphatase 2B regulatory subunit B alpha
• protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform(calcineurin B, type I)
• protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform(calcineurin B, type I)
• protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform
• Protein phosphatase 3 regulatory subunit B alpha isoform 1
• protein phosphatase 3, regulatory subunit B, alpha
• type I (19kDa)

Background

PPP3R1 is the regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. PPP3R1 confers calcium sensitivity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP3R1
• Uniprot:
  • P63098()