Cadherin-6/KCAD Recombinant Protein Antigen

Images

 
There are currently no images for Cadherin-6/KCAD Protein (NBP1-90347PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cadherin-6/KCAD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDH6.

Source: E.coli

Amino Acid Sequence: ADVGENAEIEYSITDGEGLDMFDVITDQETQEGIITVKKLLDFEKKKVYTLKVEASNPYVEPRFLYLGPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDH6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90347.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cadherin-6/KCAD Recombinant Protein Antigen

  • cadherin 6, type 2, K-cadherin (fetal kidney)
  • cadherin, fetal kidney
  • Cadherin6
  • Cadherin-6
  • CDH6
  • KCAD
  • K-cadherin (fetal kidney)
  • K-Cadherin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-58593
Species: Hu
Applications: WB, ICC/IF
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-27372
Species: Hu, Mu, Ma
Applications: WB
NBP2-48527
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87584
Species: Hu
Applications: WB, IHC, IHC-P
35740002
Species: Hu
Applications: WB, ELISA
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81410
Species: Hu
Applications: IHC, IHC-P
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
6774-CA
Species: Hu
AF7669
Species: Hu, Mu, Rt
Applications: WB
H00028513-B01P
Species: Hu
Applications: WB, ELISA
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86498
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Cadherin-6/KCAD Protein (NBP1-90347PEP) (0)

There are no publications for Cadherin-6/KCAD Protein (NBP1-90347PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cadherin-6/KCAD Protein (NBP1-90347PEP) (0)

There are no reviews for Cadherin-6/KCAD Protein (NBP1-90347PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Cadherin-6/KCAD Protein (NBP1-90347PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cadherin-6/KCAD Products

Bioinformatics Tool for Cadherin-6/KCAD Protein (NBP1-90347PEP)

Discover related pathways, diseases and genes to Cadherin-6/KCAD Protein (NBP1-90347PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cadherin-6/KCAD Protein (NBP1-90347PEP)

Discover more about diseases related to Cadherin-6/KCAD Protein (NBP1-90347PEP).
 

Pathways for Cadherin-6/KCAD Protein (NBP1-90347PEP)

View related products by pathway.

PTMs for Cadherin-6/KCAD Protein (NBP1-90347PEP)

Learn more about PTMs related to Cadherin-6/KCAD Protein (NBP1-90347PEP).

Blogs on Cadherin-6/KCAD

There are no specific blogs for Cadherin-6/KCAD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-4 [Unconjugated]
314-BP-010/CF
BMP-4 [Unconjugated]
314-BP-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cadherin-6/KCAD Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH6
Entrez