We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Cadherin-6/KCAD Recombinant Protein Antigen

Images

 
There are currently no images for Cadherin-6/KCAD Protein (NBP1-87588PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cadherin-6/KCAD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDH6.

Source: E. coli

Amino Acid Sequence: LDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDVNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDH6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87588.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cadherin-6/KCAD Recombinant Protein Antigen

  • cadherin 6, type 2, K-cadherin (fetal kidney)
  • cadherin, fetal kidney
  • Cadherin6
  • Cadherin-6
  • CDH6
  • KCAD
  • K-cadherin (fetal kidney)
  • K-Cadherin

Background

K Cadherin encodes a type II classical cadherin from the cadherin superfamily. The encoded membrane protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures such as epithelium. Strong transcriptional expression of this gene has been observed in hepatocellular and renal carcinoma cell lines, suggesting a possible role in metastasis and invasion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1790
Species: Hu
Applications: IHC, Simple Western, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
188-C8
Species: Hu
Applications: BA
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-15723
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF6677
Species: Mu
Applications: IHC, WB
H00001016-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
6770-CA
Species: Hu
Applications: BA
5604-CA
Species: Hu
Applications: BA
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
6510-CA
Species: Hu
Applications: BA
AF4096
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
6774-CA
Species: Hu
Applications: BA
NBP1-80943
Species: Hu
Applications: ICC/IF,  IHC-P
H00028513-P01
Species: Hu
Applications: ELISA, AP, PA, WB
314-BP
Species: Hu
Applications: BA, BA
NB100-417
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, MiAr, PLA, Simple Western, WB
NBP1-87588PEP
Species: Hu
Applications: AC

Publications for Cadherin-6/KCAD Protein (NBP1-87588PEP) (0)

There are no publications for Cadherin-6/KCAD Protein (NBP1-87588PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cadherin-6/KCAD Protein (NBP1-87588PEP) (0)

There are no reviews for Cadherin-6/KCAD Protein (NBP1-87588PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cadherin-6/KCAD Protein (NBP1-87588PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cadherin-6/KCAD Products

Research Areas for Cadherin-6/KCAD Protein (NBP1-87588PEP)

Find related products by research area.

Blogs on Cadherin-6/KCAD

There are no specific blogs for Cadherin-6/KCAD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cadherin-6/KCAD Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH6