Home » Cadherin-4/R-Cadherin » Cadherin-4/R-Cadherin Antibodies » Cadherin-4/R-Cadherin Antibody

Cadherin-4/R-Cadherin Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Cadherin-4/R-Cadherin Antibody [NBP1-90370] - Analysis in human cell lines U-251MG and A-431 using Anti-CDH4 antibody. Corresponding CDH4 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Orthogonal Strategies: Western Blot: Cadherin-4/R-Cadherin Antibody [NBP1-90370] - Analysis in human cell lines U-251MG and A-431 using Anti-CDH4 antibody. Corresponding CDH4 RNA-seq data are presented for the ...read more
Immunocytochemistry/ Immunofluorescence: Cadherin-4/R-Cadherin Antibody [NBP1-90370] - Staining of human cell line U-251MG shows positivity in plasma membrane. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Cadherin-4/R-Cadherin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YLIDINDNAPELLPKEAQICERPNLNAINITAADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVCPCD
Specificity
Specificity of human Cadherin-4/R-Cadherin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDH4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Publications
Read Publications using
NBP1-90370 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23608536)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cadherin-4/R-Cadherin Antibody

  • CAD4
  • cadherin 4, type 1, preproprotein
  • cadherin 4, type 1, R-cadherin (retinal)
  • Cadherin4
  • Cadherin-4
  • CDH4
  • FLJ22202
  • FLJ40547
  • MGC126700
  • MGC138355
  • RCAD
  • R-CAD
  • R-Cadherin
  • Retinal cadherin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

N-Cadherin
Antibody (13A9)
NBP1-48309
Western Blot: N-Cadherin Antibody (13A9) [NBP1-48309] - Analysis of N Cadherin expression in HeLa whole cell lysate.
Immunocytochemistry/Immunofluorescence: N-Cadherin Antibody (13A9) [NBP1-48309] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti N-Cadherin (13A9) [NBP1-48309] at a 1:100 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: N-Cadherin Antibody (13A9) [NBP1-48309] - IHC analysis of N Cadherin in mouse liver using DAB with hematoxylin counterstain.
(1 Review)
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
E-Cadherin
Antibody [Unconjugate
AF748
Western blot shows lysates of A431 human epithelial carcinoma cell line, A549 human lung carcinoma cell line, HepG2 human hepatocellular carcinoma cell line, P19 mouse embryonal carcinoma cell line, and 4T1 mouse breast cancer cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for E‑Cadherin at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of 4T1 mouse breast cancer cell line, P19 mouse embryonal carcinoma cell line, A431 human epithelial carcinoma cell line, and MCF‑7 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for E‑Cadherin at approximately 128 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
E‑Cadherin was detected in immersion fixed D3 mouse embryonic stem cell line using Goat Anti-Human/MouseE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
(5 Reviews)
(23 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Cadherin-7
6774-CA
Cadherin-7
Species: Hu
N-Cadherin
Antibody (13A9)
NBP1-48309
Western Blot: N-Cadherin Antibody (13A9) [NBP1-48309] - Analysis of N Cadherin expression in HeLa whole cell lysate.
Immunocytochemistry/Immunofluorescence: N-Cadherin Antibody (13A9) [NBP1-48309] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti N-Cadherin (13A9) [NBP1-48309] at a 1:100 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: N-Cadherin Antibody (13A9) [NBP1-48309] - IHC analysis of N Cadherin in mouse liver using DAB with hematoxylin counterstain.
(1 Review)
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Cadherin-11
Antibody (283416)
MAB1790
Cadherin‑11 was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human Cadherin‑11 Monoclonal Antibody (Catalog # MAB1790) at 8 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of PC‑3 human prostate cancer cell line, loaded at 0.2 mg/mL. Specific bands were detected for Cadherin‑11 at approximately 114 & 137 kDa (as indicated) using 20 µg/mL of Mouse Anti-Human Cadherin‑11 Monoclonal Antibody (Catalog # MAB1790). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Western blot shows lysates of PC‑3 human prostate cancer cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human Cadherin‑11 Monoclonal Antibody (Catalog # MAB1790) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Cadherin‑11 at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(4 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
Cadherin-8
188-C8
Cadherin-8
Species: Hu
Cadherin-20
5604-CA
Cadherin-20
Species: Hu
Cadherin-19
Antibody
H00028513-B01P
Western Blot: CDH19 Antibody [H00028513-B01P] - Analysis of CDH19 expression in human colon.
Western Blot: CDH19 Antibody [H00028513-B01P] - Analysis of CDH19 expression in transfected 293T cell line by CDH19 polyclonal antibody. Lane 1: CDH19 transfected lysate(84.92 KDa). Lane 2: Non-transfected lysate.
(1 Publication)
Species: Hu
Applications: WB, ELISA
P-Cadherin
Antibody [Unconjugate
AF761
P‑Cadherin was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Mouse P‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF761) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 493-conjugated Anti-Goat IgG Secondary Antibody (green; Catalog # NL003) and counterstained with DAPI (blue). Specific staining was localized to intercellular junctions. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of mouse embryo tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-MouseP‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF761) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for P‑Cadherin at approximately 115 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
P‑Cadherin was detected in immersion fixed frozen sections of mouse embryo (15 dpc) using Goat Anti-MouseP‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF761) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to connective tissue and lungs. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(1 Review)
(4 Publications)
Species: Mu
Applications: WB, Simple Western, Flow, IHC, AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
TCF-2/HNF-1 beta
Antibody
NBP1-89680
Western Blot: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Analysis in human kidney tissue.
Immunocytochemistry/Immunofluorescence: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human tonsil shows no positivity in lymphoid cells as expected.
(1 Review)
(4 Publications)
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Cadherin-6/KCAD
Antibody [Unconjugate
AF2715
Cadherin‑6/KCAD was detected in immersion fixed MG‑63 human osteosarcoma cell line using Sheep Anti-Human Cadherin‑6/KCAD Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2715) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
MG‑63 human osteosarcoma cell line was stained with Sheep Anti-Human Cadherin‑6/KCAD Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF2715, filled histogram) or control antibody (Catalog # 5-001-A, open histogram), followed by NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # NL010).
(1 Publication)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Sonic Hedgehog/Shh
[Unconjugated]
461-SH/CF
1 μg/lane of Recombinant Mouse Sonic Hedgehog/Shh, N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 23 kDa.
Recombinant Mouse Sonic Hedgehog/Shh, N-Terminus (Catalog # 461-SH/CF) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.6‑3 μg/mL.
(25 Publications)
Species: Mu
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
Immunohistochemistry-Paraffin: beta-Catenin Antibody (12F7) [NBP1-54467] - IHC analysis of beta- Catenin in mouse intestine using DAB with hematoxylin counterstain.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Protocadherin-10
Antibody
NBP2-19719
Western Blot: Protocadherin-10 Antibody [NBP2-19719] - Sample (30 ug of whole cell lysate) A: NT2D1 B: PC-3 C: U87-MG D: SK-N-SH 5% SDS PAGE diluted at 1:50
Immunohistochemistry-Paraffin: Protocadherin-10 Antibody [NBP2-19719] - Analysis of paraffin-embedded Cal27 xenograft, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
Catenin alpha 1
Antibody
NBP2-15723
Western Blot: Catenin alpha 1 Antibody [NBP2-15723] - Whole cell extract (30 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with alpha Catenin antibody [N1N3] diluted at 1:500.
Immunocytochemistry/Immunofluorescence: Catenin alpha 1 Antibody [NBP2-15723] - Immunofluorescence analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: Catenin alpha 1 Antibody [NBP2-15723] - Paraffin-embedded mouse intestine. Green: alpha Catenin antibody [N1N3] diluted at 1:200. The signal was developed using goat anti-rabbit IgG antibody (Dylight488). Blue: Nuclear staining with Hoechst 33342.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
BMP-2
[Unconjugated]
355-BM/CF
BMP-2 [Unconjugated]
(115 Publications)
Species: Hu, Mu, Rt
Protocadherin-17
Antibody
AF7669
Western blot shows lysates of mouse brain (cortex) tissue and rat brain (cerebellum) tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Protocadherin-17 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7669) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for Protocadherin-17 at approximately 120-160 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB
CDK5RAP3 Antibody
NBP1-86780
Western Blot: CDK5RAP3 Antibody [NBP1-86780] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-CDK5RAP3 antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: CDK5RAP3 Antibody [NBP1-86780] - Staining of human cell line U-2 OS shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: CDK5RAP3 Antibody [NBP1-86780] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
Immunohistochemistry-Paraffin: beta-Catenin Antibody (12F7) [NBP1-54467] - IHC analysis of beta- Catenin in mouse intestine using DAB with hematoxylin counterstain.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Cadherin-4/R-Cadherin
NBP1-90370
Cadherin-4/R-Cadherin Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for Cadherin-4/R-Cadherin Antibody (NBP1-90370)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Cadherin-4/R-Cadherin Antibody (NBP1-90370) (0)

There are no reviews for Cadherin-4/R-Cadherin Antibody (NBP1-90370). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cadherin-4/R-Cadherin Antibody (NBP1-90370) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cadherin-4/R-Cadherin Products

Bioinformatics Tool for Cadherin-4/R-Cadherin Antibody (NBP1-90370)

Discover related pathways, diseases and genes to Cadherin-4/R-Cadherin Antibody (NBP1-90370). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cadherin-4/R-Cadherin Antibody (NBP1-90370)

Discover more about diseases related to Cadherin-4/R-Cadherin Antibody (NBP1-90370).
 

Pathways for Cadherin-4/R-Cadherin Antibody (NBP1-90370)

View related products by pathway.

PTMs for Cadherin-4/R-Cadherin Antibody (NBP1-90370)

Learn more about PTMs related to Cadherin-4/R-Cadherin Antibody (NBP1-90370).

Blogs on Cadherin-4/R-Cadherin

There are no specific blogs for Cadherin-4/R-Cadherin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cadherin-4/R-Cadherin Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CDH4
Entrez