Cadherin-4/R-Cadherin Antibody

Images

 
Western Blot: Cadherin-4/R-Cadherin Antibody [NBP1-90370] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Cadherin-4/R-Cadherin Antibody [NBP1-90370] - Staining of human cell line U-251MG shows positivity in plasma membrane.
Immunohistochemistry-Paraffin: Cadherin-4/R-Cadherin Antibody [NBP1-90370] - Staining of human cervix, uterine shows cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Cadherin-4/R-Cadherin Antibody [NBP1-90370] - Staining of human cervix, uterine shows cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Product Discontinued
View other related Cadherin-4/R-Cadherin Primary Antibodies

Order Details


    • Catalog Number
      NBP1-90370
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cadherin-4/R-Cadherin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YLIDINDNAPELLPKEAQICERPNLNAINITAADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVCPCD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDH4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Publications
Read Publications using
NBP1-90370 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23608536)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cadherin-4/R-Cadherin Antibody

  • CAD4
  • cadherin 4, type 1, preproprotein
  • cadherin 4, type 1, R-cadherin (retinal)
  • Cadherin4
  • Cadherin-4
  • CDH4
  • FLJ22202
  • FLJ40547
  • MGC126700
  • MGC138355
  • RCAD
  • R-CAD
  • R-Cadherin
  • Retinal cadherin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
6774-CA
Species: Hu
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-58593
Species: Hu
Applications: WB, ICC/IF
35740002
Species: Hu
Applications: WB, ELISA
H00028513-B01P
Species: Hu
Applications: WB, ELISA
AF761
Species: Mu
Applications: WB, Simple Western, Flow, IHC, AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2715
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
355-BM/CF
Species: Hu, Mu, Rt
AF7669
Species: Hu, Mu, Rt
Applications: WB
NBP1-86780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-90370
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cadherin-4/R-Cadherin Antibody (NBP1-90370)(2)

Reviews for Cadherin-4/R-Cadherin Antibody (NBP1-90370) (0)

There are no reviews for Cadherin-4/R-Cadherin Antibody (NBP1-90370). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cadherin-4/R-Cadherin Antibody (NBP1-90370) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cadherin-4/R-Cadherin Products

Bioinformatics Tool for Cadherin-4/R-Cadherin Antibody (NBP1-90370)

Discover related pathways, diseases and genes to Cadherin-4/R-Cadherin Antibody (NBP1-90370). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cadherin-4/R-Cadherin Antibody (NBP1-90370)

Discover more about diseases related to Cadherin-4/R-Cadherin Antibody (NBP1-90370).
 

Pathways for Cadherin-4/R-Cadherin Antibody (NBP1-90370)

View related products by pathway.

PTMs for Cadherin-4/R-Cadherin Antibody (NBP1-90370)

Learn more about PTMs related to Cadherin-4/R-Cadherin Antibody (NBP1-90370).

Blogs on Cadherin-4/R-Cadherin

There are no specific blogs for Cadherin-4/R-Cadherin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cadherin-4/R-Cadherin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH4
Entrez