Cadherin-4/R-Cadherin Antibody (2E2.)

Images

 
Sandwich ELISA: Cadherin-4/R-Cadherin Antibody (2E2) [H00001002-M01] - Detection limit for recombinant GST tagged CDH4 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2E2.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cadherin-4/R-Cadherin Antibody (2E2.) Summary

Immunogen
CDH4 (NP_001785 635 a.a. - 734 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVCPCDDNGDCTTIGAVAAAGLGTGA
Specificity
CDH4 - cadherin 4, type 1, R-cadherin (retinal)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDH4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cadherin-4/R-Cadherin Antibody (2E2.)

  • CAD4
  • cadherin 4, type 1, preproprotein
  • cadherin 4, type 1, R-cadherin (retinal)
  • Cadherin4
  • Cadherin-4
  • CDH4
  • FLJ22202
  • FLJ40547
  • MGC126700
  • MGC138355
  • RCAD
  • R-CAD
  • R-Cadherin
  • Retinal cadherin

Background

This gene is a classical cadherin from the cadherin superfamily. The encoded protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Based on studies in chicken and mouse, this cadherin is thought to play an important role during brain segmentation and neuronal outgrowth. In addition, a role in kidney and muscle development is indicated. Of particular interest are studies showing stable cis-heterodimers of cadherins 2 and 4 in cotransfected cell lines. Previously thought to interact in an exclusively homophilic manner, this is the first evidence of cadherin heterodimerization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
6774-CA
Species: Hu
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-58593
Species: Hu
Applications: WB, ICC/IF
35740002
Species: Hu
Applications: WB, ELISA
H00028513-B01P
Species: Hu
Applications: WB, ELISA
AF761
Species: Mu
Applications: WB, Simple Western, Flow, IHC, AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2715
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
355-BM/CF
Species: Hu, Mu, Rt
AF7669
Species: Hu, Mu, Rt
Applications: WB
NBP1-86780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00001002-M01
Species: Hu
Applications: WB, ELISA

Publications for Cadherin-4/R-Cadherin Antibody (H00001002-M01) (0)

There are no publications for Cadherin-4/R-Cadherin Antibody (H00001002-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cadherin-4/R-Cadherin Antibody (H00001002-M01) (0)

There are no reviews for Cadherin-4/R-Cadherin Antibody (H00001002-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cadherin-4/R-Cadherin Antibody (H00001002-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cadherin-4/R-Cadherin Products

Bioinformatics Tool for Cadherin-4/R-Cadherin Antibody (H00001002-M01)

Discover related pathways, diseases and genes to Cadherin-4/R-Cadherin Antibody (H00001002-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cadherin-4/R-Cadherin Antibody (H00001002-M01)

Discover more about diseases related to Cadherin-4/R-Cadherin Antibody (H00001002-M01).
 

Pathways for Cadherin-4/R-Cadherin Antibody (H00001002-M01)

View related products by pathway.

PTMs for Cadherin-4/R-Cadherin Antibody (H00001002-M01)

Learn more about PTMs related to Cadherin-4/R-Cadherin Antibody (H00001002-M01).

Blogs on Cadherin-4/R-Cadherin

There are no specific blogs for Cadherin-4/R-Cadherin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cadherin-4/R-Cadherin Antibody (2E2.) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH4
Entrez
OMIM
Uniprot