Cadherin-20 Antibody - BSA Free

Western Blot: Cadherin-20 Antibody [NBP3-10609] - Western blot analysis of Cadherin-20 in Rat Stomach lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Cadherin-20 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cadherin-20 Antibody - BSA Free (NBP3-10609) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Cadherin-20 (NP_001012766). Peptide sequence DVTIGTTIQIISAKDPDMTNNSIRYSIDRGSDPGRFFYVDITTGALMTAR
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDH20
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 88 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Cadherin-20 Antibody - BSA Free

• cadherin 20, type 2
• Cadherin20
• Cadherin-20
• CDH20
• CDH7L3Cdh7
• FLJ37047

Background

The CDH20 gene is a type II classical cadherin from the cadherin superfamily and one of three cadherin 7-like genes located in a cluster on chromosome 18. The encoded membrane protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five ext

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDH20