Recombinant Human CACNB2 Protein

Images

 
SDS-Page: Recombinant Human CACNB2 Protein [H00000783-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CACNB2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-89 of Human CACNB2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CACNB2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CACNB2 Protein

  • CAB2
  • CACNLB2
  • Calcium channel voltage-dependent subunit beta 2
  • calcium channel, voltage-dependent, beta 2 subunit
  • CAVB2
  • FLJ23743
  • Lambert-Eaton myasthenic syndrome antigen B
  • myasthenic (Lambert-Eaton) syndrome antigen B
  • MYSB
  • voltage-dependent L-type calcium channel subunit beta-2

Background

CACNB2 - calcium channel, voltage-dependent, beta 2 subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5489
Species: Hu
Applications: WB, IHC
NBP1-86589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00010948-M01
Species: Hu
Applications: WB, ELISA
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP1-83984
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12907
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-2864
Species: Hu, Mu, Rt, Po, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-12893
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-13914
Species: Hu
Applications: ICC/IF, IHC, IHC-P
37470002
Species: Hu
Applications: WB, ELISA
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-52926
Species: Hu
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for CACNB2 Partial Recombinant Protein (H00000783-Q01) (0)

There are no publications for CACNB2 Partial Recombinant Protein (H00000783-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNB2 Partial Recombinant Protein (H00000783-Q01) (0)

There are no reviews for CACNB2 Partial Recombinant Protein (H00000783-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CACNB2 Partial Recombinant Protein (H00000783-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CACNB2 Products

Bioinformatics Tool for CACNB2 Partial Recombinant Protein (H00000783-Q01)

Discover related pathways, diseases and genes to CACNB2 Partial Recombinant Protein (H00000783-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNB2 Partial Recombinant Protein (H00000783-Q01)

Discover more about diseases related to CACNB2 Partial Recombinant Protein (H00000783-Q01).
 

Pathways for CACNB2 Partial Recombinant Protein (H00000783-Q01)

View related products by pathway.

PTMs for CACNB2 Partial Recombinant Protein (H00000783-Q01)

Learn more about PTMs related to CACNB2 Partial Recombinant Protein (H00000783-Q01).

Blogs on CACNB2

There are no specific blogs for CACNB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CACNB2 Antibody (6C4)
H00000783-M05
ErbB2/Her2
1129-ER-050

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CACNB2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNB2