CACNA2D3 Antibody - BSA Free

Western Blot: CACNA2D3 Antibody [NBP2-83961] - Host: Rabbit. Target Name: CACNA2D3. Sample Tissue: Human Mesenchymoma Tumor lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CACNA2D3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CACNA2D3. Peptide sequence: THPELRLLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CACNA2D3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CACNA2D3 Antibody - BSA Free

• calcium channel, voltage-dependent, alpha 2/delta subunit 3
• voltage-dependent calcium channel subunit alpha-2/delta-3
• voltage-dependent, alpha 2/delta 3 subunit

Background

The CACNA2D3 gene encodes a voltage-dependent calcium channel subunit alpha-2/delta-3 protein that exists in three isoforms: isoform 1: 1,091 amino acids long, 123 kDA; isoform 2: 997 amino acids long, 112 kDA; and isoform 3: 519 amino acids long, 59 kDA. These proteins are critical in calcium current density and in activation and inactivation kinetics of the calcium channel. Additionally, these proteins function as regulatory subunits for P/Q-type calcium channel, N-type, and L-type, but not T-type. The CACNA2D3 gene participates in the transcription CREB pathway, Fc-GammaRpathway, PDGF and BMP pathways, as well as the transmission across chemical synapses. It is known to interact with genes PRKACA, PRKACB, PRKACG, YWHAB, and RAD51C. CACNA2D3 is associated with carcinoma, neuronitis, gastric cancer, night blindness, laband syndrome, hypertrichosis, and zimmermann-laband syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CACNA2D3