CACNA2D1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CACNA2D1 Antibody [NBP1-86682] - Staining in human skeletal muscle and pancreas tissues . Corresponding CACNA2D1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CACNA2D1 Antibody [NBP1-86682] - Staining of human cerebellum, cerebral cortex, pancreas and skeletal muscle using Anti-CACNA2D1 antibody NBP1-86682 (A) shows similar protein distribution across tissues to independent antibody NBP1-86683 (B).

Immunohistochemistry-Paraffin: CACNA2D1 Antibody [NBP1-86682] - Staining of human cerebral cortex shows weak positivity in neuropil.

Immunohistochemistry-Paraffin: CACNA2D1 Antibody [NBP1-86682] - Staining of human cerebellum shows moderate positivity.

Immunohistochemistry-Paraffin: CACNA2D1 Antibody [NBP1-86682] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: CACNA2D1 Antibody [NBP1-86682] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CACNA2D1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QFLLSLTFPRLLEAVEMEDDDFTASLSKQSCITEQTQYFFDNDSKSFSGVLDCGNCSRIFHGEKLMNTNLIFIMVESKGTCPCDTRLLIQAEQTSDGPNPCDMVKQPRYRKGP
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CACNA2D1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CACNA2D1 Protein (NBP1-86682PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CACNA2D1 Antibody - BSA Free

• CACNA2
• CACNA2D1
• CACNL2A
• CACNL2Adihydropyridine-sensitive L-type, calcium channel alpha-2/delta subunit
• calcium channel, L type, alpha 2 polypeptide
• calcium channel, voltage-dependent, alpha 2/delta subunit 1
• CCHL2A
• MHS3
• voltage-dependent calcium channel subunit alpha-2/delta-1
• Voltage-gated calcium channel subunit alpha-2/delta-1

Background

The CACNA2D1 gene encodes a voltage-dependent calcium channel subunit alpha-2/delta-1 protein that exists in 5 isoforms: isoform 1: 1,103 amino acids long, 124 kDA; isoform 2: 1,091 amino acids long, 123 kDA; isoform 3: 1,086 amino acids long, 122 kDA; isoform 4: 1,079 amino acids long, 121 kDA; and isoform 5: 1,084 amino acids long, 122 kDA. These proteins are critical in calcium current density and in activation and inactivation kinetics of the calcium channel. Additionally, these proteins function in excitation-contraction coupling. The CACNA2D1 gene participates in transcription of the CREB pathway, the caspase cascade, Fc-GammaR pathway, BMP and PDGF pathways, MAPK signaling pathway, and cardiac muscle contraction. It is known to interact with genes DLG4, CACNA1C, CACNA1D, CACNA1F, and YWHAB. The CACNA2D1 gene is associated with neuroblastoma, heart blocks, liver disease, parkinson's disease, dementia, malignant hyperthermia susceptibility, lambert-eaton myasthenic syndrome, timothy syndrome, peripheral neropathy, and fatty liver disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CACNA2D1