CACNA1S Antibody - BSA Free

Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541] - Analysis in human skeletal muscle and prostate tissues. Corresponding CACNA1S RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541] - Staining of human cervix, uterine shows no positivity in squamous epithelial cells as expected.

Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541] - Staining of human prostate shows no positivity in smooth muscle cells as expected.

Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33541] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CACNA1S Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CACNA1S Antibody - BSA Free (NBP2-33541) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ESPVFLEDFPQDPRTNPLARANTNNANANVAYGNSNHSNSHVFSSVHYEREFPEETETPATRGRALGQPCRVLGPHSKPCVE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CACNA1S
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CACNA1S Protein (NBP2-33541PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CACNA1S Antibody - BSA Free

• CACH1
• CACN1
• CACNA1S
• CACNL1A3
• CACNL1A3MHS5
• calcium channel, L type, alpha 1 polypeptide, isoform 3 (skeletal muscle
• Calcium channel, L type, alpha-1 polypeptide, isoform 3, skeletal muscle
• calcium channel, voltage-dependent, L type, alpha 1S subunit
• Cav1.1
• CCHL1A3
• dihydropyridine receptor
• dihydropyridine-sensitive L-type calcium channel alpha-1 subunit
• HOKPP
• HOKPP1
• hypokalemic periodic paralysis)
• hypoPP
• TTPP1
• voltage-dependent L-type calcium channel subunit alpha-1S
• Voltage-gated calcium channel subunit alpha Cav1.1

Background

Voltage-sensitive calcium channels mediate the entry of calcium into many types of excitable cells and thus play a key role in neurotransmitter release and excitation-contraction (E-C) coupling. The 1,4-dihydropyridines (DHPs) are synthetic organic compounds which can be used to identify the L-type calcium channels that are found in all types of vertebrate muscle, neuronal and neuroendocrine cells. The DHP receptor is part of the L-type calcium channel complex and is thought to be the voltage sensor in E-C coupling.The purified DHP receptor isolated from triads is composed of at least four subunits. The alpha-1 subunit contains the binding site for the DHPs and shows high sequence homology to the voltage gated sodium channel. The alpha-2 subunit is a large glycoprotein associated with the DHP receptor which was first described in skeletal muscle and is also found in high concentrations in other excitable tissues such as cardiac muscle and brain and in low concentrations in most other tissues studied. The other two subunits that co-purify with the DHP receptor are termed beta and gamma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CACNA1S
• Uniprot:
  • Q13698(Human)