Novus Biologicals products are now on bio-techne.com

CABLES2 Recombinant Protein Antigen

Images

 
There are currently no images for CABLES2 Recombinant Protein Antigen (NBP2-58453PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CABLES2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CABLES2.

Source: E. coli

Amino Acid Sequence: AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CABLES2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58453.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CABLES2 Recombinant Protein Antigen

  • C20orf150
  • Cdk5 and Abl enzyme substrate 2
  • CDK5 and ABL1 enzyme substrate 2
  • chromosome 20 open reading frame 150
  • dJ908M14.2
  • ik3-2
  • Interactor with CDK3 2

Background

CABLES2 - Cdk5 and Abl enzyme substrate 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00091768-B01P
Species: Hu
Applications: ICC/IF, WB
NBP2-37602
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00001018-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-74611
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
302-B2
Species: Hu
Applications: BA
NBP2-94538
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-58116
Species: Hu
Applications: ICC/IF, KD, WB
NB100-847
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB100-183
Species: Hu
Applications: WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-41190
Species: Ch, Hu, Mu
Applications: B/N, ICC/IF, IP, PLA, WB
D1600
Species: Hu
Applications: ELISA
NBP1-83078
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77158
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF3495
Species: Hu
Applications: IHC, WB
AF3416
Species: Hu
Applications: WB

Publications for CABLES2 Recombinant Protein Antigen (NBP2-58453PEP) (0)

There are no publications for CABLES2 Recombinant Protein Antigen (NBP2-58453PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CABLES2 Recombinant Protein Antigen (NBP2-58453PEP) (0)

There are no reviews for CABLES2 Recombinant Protein Antigen (NBP2-58453PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CABLES2 Recombinant Protein Antigen (NBP2-58453PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CABLES2 Products

Array NBP2-58453PEP

Research Areas for CABLES2 Recombinant Protein Antigen (NBP2-58453PEP)

Find related products by research area.

Blogs on CABLES2

There are no specific blogs for CABLES2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CABLES2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CABLES2