Recombinant Human CABLES2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human CABLES2 Protein [H00081928-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human CABLES2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 131-239 of Human CABLES2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LEFLEDAVGCAPAQRTKHTSGSPRHKGLKKTHFIKNMRQYDTRNSRIVLICAKRSLCAAFSVLPYGEGLRISDLRVDSQKQRHPSGGVSVSSEMVFELEGVELGADGKV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CABLES2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CABLES2 GST (N-Term) Protein

  • C20orf150
  • Cdk5 and Abl enzyme substrate 2
  • CDK5 and ABL1 enzyme substrate 2
  • chromosome 20 open reading frame 150
  • dJ908M14.2
  • ik3-2
  • Interactor with CDK3 2

Background

CABLES2 - Cdk5 and Abl enzyme substrate 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92697
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-15843
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00001018-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-74611
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
302-B2/CF
Species: Hu
Applications: BA
NBP2-94538
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-58116
Species: Hu
Applications: ICC/IF, KD, WB
NB100-847
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB100-183
Species: Hu
Applications: WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92719
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
D1600
Species: Hu
Applications: ELISA
NBP1-83078
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77158
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF3495
Species: Hu
Applications: IHC, WB
AF3416
Species: Hu
Applications: WB

Publications for CABLES2 Partial Recombinant Protein (H00081928-Q01) (0)

There are no publications for CABLES2 Partial Recombinant Protein (H00081928-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CABLES2 Partial Recombinant Protein (H00081928-Q01) (0)

There are no reviews for CABLES2 Partial Recombinant Protein (H00081928-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CABLES2 Partial Recombinant Protein (H00081928-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CABLES2 Products

Array H00081928-Q01

Bioinformatics Tool for CABLES2 Partial Recombinant Protein (H00081928-Q01)

Discover related pathways, diseases and genes to CABLES2 Partial Recombinant Protein (H00081928-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CABLES2 Partial Recombinant Protein (H00081928-Q01)

Discover more about diseases related to CABLES2 Partial Recombinant Protein (H00081928-Q01).
 

Pathways for CABLES2 Partial Recombinant Protein (H00081928-Q01)

View related products by pathway.

Research Areas for CABLES2 Partial Recombinant Protein (H00081928-Q01)

Find related products by research area.

Blogs on CABLES2

There are no specific blogs for CABLES2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CABLES2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CABLES2