C6orf120 Antibody

Images

 
Western Blot: C6orf120 Antibody [NBP1-88979] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: C6orf120 Antibody [NBP1-88979] - Staining of human pancreas shows strong cytoplasmic positivity in granular pattern in exocrine pancreas.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C6orf120 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PEEWVLLHVVQGQIGAGNYSYLRLNHEGKIVLRMRSLKGDADLYVSASSLHPSFDDYELQSATCGPDAVSIPAHFRRPVGIGVYGH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C6ORF120
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C6orf120 Protein (NBP1-88979PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C6orf120 Antibody

  • bA160E12.4
  • chromosome 6 open reading frame 120
  • hypothetical protein LOC387263

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP2-05096
Species: Hu
AF3970
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-83915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP1-80857
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-76240
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-92683
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-86566
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90278
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19795
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89714
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for C6orf120 Antibody (NBP1-88979) (0)

There are no publications for C6orf120 Antibody (NBP1-88979).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C6orf120 Antibody (NBP1-88979) (0)

There are no reviews for C6orf120 Antibody (NBP1-88979). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C6orf120 Antibody (NBP1-88979) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C6orf120 Products

Bioinformatics Tool for C6orf120 Antibody (NBP1-88979)

Discover related pathways, diseases and genes to C6orf120 Antibody (NBP1-88979). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C6orf120 Antibody (NBP1-88979)

Discover more about diseases related to C6orf120 Antibody (NBP1-88979).
 

Pathways for C6orf120 Antibody (NBP1-88979)

View related products by pathway.

PTMs for C6orf120 Antibody (NBP1-88979)

Learn more about PTMs related to C6orf120 Antibody (NBP1-88979).

Blogs on C6orf120

There are no specific blogs for C6orf120, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C6orf120 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C6ORF120