C1GALT1 Antibody - BSA Free

Western Blot: C1GALT1 Antibody [NBP1-69602] - This Anti-C1GALT1 antibody was used in Western Blot of HT1080 tissue lysate at a concentration of 1ug/ml.

Product Discontinued

C1GALT1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to C1GALT1(core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1) The peptide sequence was selected from the middle region of C1GALT1. Peptide sequence NVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C1GALT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for C1GALT1 Antibody - BSA Free

• B3Gal-T8
• Beta-1,3-galactosyltransferase
• C1GALT
• C1GalT1
• Core 1 beta1,3-galactosyltransferase 1
• Core 1 Beta3-Gal-T1
• Core 1 O-Glycan T-Synthase
• core 1 synthase, glycoprotein-N-acetylgalactosamine3-beta-galactosyltransferase, 1
• Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta1,3-galactosyltransferase 1
• EC 2.4.1.122
• glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
• T-synthase

Background

The common core 1 O-glycan structure Gal-beta-1-3GalNAc-R is a precursor for many extended mucin-type O-glycan structures in animal cell surface and secreted glycoproteins. Core 1 is synthesized by the transfer of Gal from UDP-Gal to GalNAc-alpha-1-R by c

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for C1GALT1 Antibody (NBP1-69602). (Showing 1 - 1 of 1 FAQ).

1. Regarding your C1GALT1 antibody with murine specificity, do you have any published articles with this antibody?
   • Any publications we know of using each product are shown in the Images, Reviews & Publications tab. Unfortunately at this time, we are not aware of any publications using this antibody.

Bioinformatics

• Gene Symbol: C1GALT1
• Uniprot:
  • Q9NS00(Human)