C16orf62 Antibody

Images

 
Immunohistochemistry-Paraffin: C16orf62 Antibody [NBP1-82744] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C16orf62 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ENNKLCETVMAQILEHLKTLAKDEALKRQSSLGLSFFNSILAHGDLRNNKLNQLSVNLWHLAQRHGCADTRTMVKTLEYIKKQSKQPDMTHLTELA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C16ORF62
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C16orf62 Protein (NBP1-82744PEP)
Publications
Read Publication using NBP1-82744.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C16orf62 Antibody

  • chromosome 16 open reading frame 62
  • DKFZp313M0539
  • DKFZp434B0212
  • esophageal cancer associated protein
  • Esophageal cancer-associated protein
  • FLJ21040
  • hypothetical protein LOC57020
  • MGC16824

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3656
Species: Hu
Applications: Flow, CyTOF-ready, ICC
MAB2545
Species: Hu
Applications: WB, IHC, IP
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH
NBP1-92280
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003400-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-26616
Species: Hu
Applications: WB, IP
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready

Publications for C16orf62 Antibody (NBP1-82744)(1)

Reviews for C16orf62 Antibody (NBP1-82744) (0)

There are no reviews for C16orf62 Antibody (NBP1-82744). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for C16orf62 Antibody (NBP1-82744) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C16orf62 Products

Bioinformatics Tool for C16orf62 Antibody (NBP1-82744)

Discover related pathways, diseases and genes to C16orf62 Antibody (NBP1-82744). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C16orf62 Antibody (NBP1-82744)

Discover more about diseases related to C16orf62 Antibody (NBP1-82744).
 

Pathways for C16orf62 Antibody (NBP1-82744)

View related products by pathway.

PTMs for C16orf62 Antibody (NBP1-82744)

Learn more about PTMs related to C16orf62 Antibody (NBP1-82744).

Blogs on C16orf62

There are no specific blogs for C16orf62, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C16orf62 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C16ORF62