C12orf4 Antibody - BSA Free

Images

 
Western Blot: C12orf4 Antibody [NBP1-70429] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

C12orf4 Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to C12ORF4 The peptide sequence was selected from the middle region of C12orf4. Peptide sequence QELGKSLTDQDVNSLAAQHFESQQDLENKWSNELKQSTAIQKQEYQEWVI. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C12ORF4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for C12orf4 Antibody - BSA Free

  • chromosome 12 open reading frame 4
  • hypothetical protein LOC57102

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56745
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-74709
Species: Ca, Hu, Pm, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-84177
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-52085
Species: Hu, Mu
Applications: PEP-ELISA, WB
NBP3-47527
Species: Hu, Mu, Rt
Applications: ELISA, IHC
NBP3-03729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-81771
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-35697
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-22439
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
H00001663-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NB600-844
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-72614
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-16766
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
1958-GD
Species: Hu, Mu, Rt
Applications: BA
NBP2-13442
Species: Hu
Applications: IHC,  IHC-P
NBP1-70429
Species: Hu
Applications: WB

Publications for C12orf4 Antibody (NBP1-70429) (0)

There are no publications for C12orf4 Antibody (NBP1-70429).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C12orf4 Antibody (NBP1-70429) (0)

There are no reviews for C12orf4 Antibody (NBP1-70429). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C12orf4 Antibody (NBP1-70429) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C12orf4 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol C12ORF4