C11orf54 Antibody

Images

 
Western Blot: C11orf54 Antibody [NBP1-87194] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: C11orf54 Antibody [NBP1-87194] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: C11orf54 Antibody [NBP1-87194] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.
Western Blot: C11orf54 Antibody [NBP1-87194] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C11orf54 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MACAEFSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEIKLPGAFILGAGAG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C11ORF54
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C11orf54 Protein (NBP1-87194PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C11orf54 Antibody

  • chromosome 11 open reading frame 54
  • EC 3.1
  • ester hydrolase C11orf54
  • LP4947
  • PTD012

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF

Publications for C11orf54 Antibody (NBP1-87194) (0)

There are no publications for C11orf54 Antibody (NBP1-87194).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C11orf54 Antibody (NBP1-87194) (0)

There are no reviews for C11orf54 Antibody (NBP1-87194). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C11orf54 Antibody (NBP1-87194) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C11orf54 Products

Bioinformatics Tool for C11orf54 Antibody (NBP1-87194)

Discover related pathways, diseases and genes to C11orf54 Antibody (NBP1-87194). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C11orf54

There are no specific blogs for C11orf54, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C11orf54 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C11ORF54