Immunocytochemistry/ Immunofluorescence: BYSL Antibody [NBP1-89501] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Independent Antibodies: Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human gastrointestinal, lymphoid tissues, placenta and testis using Anti-BYSL antibody NBP1-89501 (A) shows similar ...read more
Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human placenta shows strong positivity in nucleoli in trophoblastic cells.
Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human testis shows moderate positivity in nucleoli in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human lymph node shows strong positivity in nucleoli in lymphoid cells.
Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human rectum shows strong positivity in nucleoli in glandular cells.
Independent Antibodies: Western Blot: BYSL Antibody [NBP1-89501] - Analysis using Anti-BYSL antibody NBP1-89501 (A) shows similar pattern to independent antibody NBP1-89500 (B).
BYSL is related to the poor prognosis of patients with osteosarcoma. (A) Cluster heatmap of differentially expressed genes in GSE126209. (B) Overall survival was compared between osteosarcoma patients with high and low ...read more
BYSL knockdown partially abolishes miR-378a-3p-mediated osteosarcoma cell epithelial-to-mesenchymal transition (EMT), invasion, migration, and apoptosis under normoxia. (A) MG63 and Saos-2 cells were transfected with ...read more
BYSL is a direct target of miR-378a-3p. (A) MG63 and Saos-2 cells were cultured under hypoxic or normoxic conditions. The RNA levels of miR-378a-3p and BYSL were measured by RT-qPCR. (B) The 3′-untranslated region ...read more
BYSL knockdown partially abolishes miR-378a-3p-mediated osteosarcoma cell epithelial-to-mesenchymal transition (EMT), invasion, migration, and apoptosis under normoxia. (A) MG63 and Saos-2 cells were transfected with ...read more
BYSL overexpression rescues the effect of miR-378a-3p overexpression on osteosarcoma cells under hypoxia. (A) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC) or miR-378a-3p-mimic, and then cultured ...read more
BYSL overexpression rescues the effect of miR-378a-3p overexpression on osteosarcoma cells under hypoxia. (A) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC) or miR-378a-3p-mimic, and then cultured ...read more
BYSL is related to the poor prognosis of patients with osteosarcoma. (A) Cluster heatmap of differentially expressed genes in GSE126209. (B) Overall survival was compared between osteosarcoma patients with high and low ...read more
Novus Biologicals Rabbit BYSL Antibody - BSA Free (NBP1-89501) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-BYSL Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRELQSAVPRDVEDVPITVE
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BYSL
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for BYSL Antibody - BSA Free
by the ribosomal protein s6 gene, drosophila, homolog-like
BYSTIN
bystin-like
Background
Bystin is expressed as a 2-kb major transcript and a 3.6-kb minor transcript in SNG-M cells and in human trophoblastic teratocarcinoma HT-H cells. Protein binding assays determined that bystin binds directly to trophinin and tastin, and that binding is enhanced when cytokeratins 8 and 18 are present. Immunocytochemistry of HT-H cells showed that bystin colocalizes with trophinin, tastin, and the cytokeratins, suggesting that these molecules form a complex in trophectoderm cells at the time of implantation. Using immunohistochemistry it was determined that trophinin and bystin are found in the placenta from the sixth week of pregnancy. Both proteins were localized in the cytoplasm of the syncytiotrophoblast in the chorionic villi and in endometrial decidual cells at the uteroplacental interface. After week 10, the levels of trophinin, tastin, and bystin decreased and then disappeared from placental villi.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our BYSL Antibody - BSA Free and receive a gift card or discount.