BTBD14A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BTBD14A Antibody [NBP2-30655] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoli & mitochondria.
Immunohistochemistry: BTBD14A Antibody [NBP2-30655] - Staining of human colon shows moderate cytoplasmic and nucleolar positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BTBD14A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DEEDDEAYDTMVEEQYGQMYIKASGSYAVQEKPEPVPLESRSCVLIRRDLVALPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NACC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BTBD14A Protein (NBP2-30655PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BTBD14A Antibody

  • BEN domain containing 9
  • BEND9
  • BTB (POZ) domain containing 14A
  • BTB/POZ domain-containing protein 14A
  • BTBD14
  • BTBD14A
  • MGC23427
  • NAC2
  • NAC-2
  • NACC family member 2, BEN and BTB (POZ) domain containing
  • nucleus accumbens-associated protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54899
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB110-77345
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30583
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58876
Species: Hu
Applications: ICC/IF
NBP1-62518
Species: Hu
Applications: WB, IHC, IHC-P
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP2-49637
Species: Hu
Applications: WB, IHC
NBP2-26061
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, PEP-ELISA
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-30655
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for BTBD14A Antibody (NBP2-30655) (0)

There are no publications for BTBD14A Antibody (NBP2-30655).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTBD14A Antibody (NBP2-30655) (0)

There are no reviews for BTBD14A Antibody (NBP2-30655). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BTBD14A Antibody (NBP2-30655) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTBD14A Products

Bioinformatics Tool for BTBD14A Antibody (NBP2-30655)

Discover related pathways, diseases and genes to BTBD14A Antibody (NBP2-30655). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on BTBD14A

There are no specific blogs for BTBD14A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTBD14A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NACC2
Uniprot