Recombinant Human BSPRY Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human BSPRY Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-193 of Human BSPRY full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEIFERHRGHTDR

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
BSPRY
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
47.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BSPRY Protein

  • B box and SPRY domain-containing protein
  • B-box and SPRY domain containing
  • B-box and SPRY-domain containing protein
  • FLJ20150
  • zetin 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
AF-237-NA
Species: Hu
Applications: WB, IHC, Neut
NBP1-98474
Species: Hu
Applications: WB
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB300-186
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-402
Species: Hu, Mu, Rt, Po, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00054836-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for BSPRY Recombinant Protein (H00054836-P01) (0)

There are no publications for BSPRY Recombinant Protein (H00054836-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BSPRY Recombinant Protein (H00054836-P01) (0)

There are no reviews for BSPRY Recombinant Protein (H00054836-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BSPRY Recombinant Protein (H00054836-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for BSPRY Recombinant Protein (H00054836-P01)

Discover related pathways, diseases and genes to BSPRY Recombinant Protein (H00054836-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BSPRY Recombinant Protein (H00054836-P01)

Discover more about diseases related to BSPRY Recombinant Protein (H00054836-P01).
 

Pathways for BSPRY Recombinant Protein (H00054836-P01)

View related products by pathway.

Blogs on BSPRY

There are no specific blogs for BSPRY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BSPRY Antibody
NBP1-82204

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BSPRY Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BSPRY