BRN4 Antibody

Images

 
Western Blot: BRN4 Antibody [NBP1-89934] - Analysis in human cerebral cortex tissue.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BRN4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDH
Specificity
Specificity of human BRN4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POU3F4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
Control Peptide
Publications
Read Publication using NBP1-89934.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24205242).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BRN4 Antibody

  • brain-specific homeobox/POU domain protein 4
  • octamer-binding transcription factor 9
  • OTF9
  • POU class 3 homeobox 4
  • POU domain, class 3, transcription factor 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21585
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-49872
Species: Mu
Applications: WB, IHC, IHC-Fr, PEP-ELISA
NBP2-27559
Species: Hu
Applications: WB, PEP-ELISA
NB100-57840
Species: Hu, Mu, Rt
Applications: WB, Flow, PEP-ELISA
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-46076
Species: Hu
Applications: WB, IHC
AF3444
Species: Hu
Applications: WB
H00002707-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-750
Species: Hu, Mu, Rt, Fi, Mk, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
NBP1-84954
Species: Hu
Applications: IHC, IHC-P
NBP1-31654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu, Mk
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-06579
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-84079
Species: Hu
Applications: WB, IHC, IHC-P

Publications for BRN4 Antibody (NBP1-89934)(1)

Reviews for BRN4 Antibody (NBP1-89934) (0)

There are no reviews for BRN4 Antibody (NBP1-89934). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRN4 Antibody (NBP1-89934) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BRN4 Products

Bioinformatics Tool for BRN4 Antibody (NBP1-89934)

Discover related pathways, diseases and genes to BRN4 Antibody (NBP1-89934). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRN4 Antibody (NBP1-89934)

Discover more about diseases related to BRN4 Antibody (NBP1-89934).
 

Pathways for BRN4 Antibody (NBP1-89934)

View related products by pathway.

PTMs for BRN4 Antibody (NBP1-89934)

Learn more about PTMs related to BRN4 Antibody (NBP1-89934).

Blogs on BRN4

There are no specific blogs for BRN4, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRN4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POU3F4
COVID-19 update