Home » BRN3A » BRN3A Antibodies » BRN3A Antibody (7B4)

BRN3A Antibody (7B4)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: BRN3A Antibody (7B4) [H00005457-M04] - Analysis of POU4F1 expression in transfected 293T cell line by POU4F1 monoclonal antibody (M04), clone 7B4. Lane 1: POU4F1 transfected lysatE (46.09 KDa). Lane 2: Non-transfected lysate.
Western Blot: BRN3A Antibody (7B4) [H00005457-M04] - Analysis of POU4F1 expression in transfected 293T cell line by POU4F1 monoclonal antibody (M04), clone 7B4. Lane 1: POU4F1 transfected lysatE (46.09 KDa). Lane 2: ...read more
ELISA: BRN3A Antibody (7B4) [H00005457-M04] - Detection limit for recombinant GST tagged POU4F1 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
7B4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

BRN3A Antibody (7B4) Summary

Immunogen
POU4F1 (NP_006228.2, 331 a.a. - 420 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
POU4F1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BRN3A Antibody (7B4)

  • Brain-3A
  • Brain-specific homeobox/POU domain protein 3A
  • brn-3A
  • BRN3Abrain-3A
  • FLJ13449
  • Homeobox/POU domain protein RDC-1
  • Oct-T1
  • POU class 4 homeobox 1
  • POU domain class 4, transcription factor 1
  • POU domain, class 4, transcription factor 1
  • RDC1
  • RDC-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BRN3B/POU4F2
Antibody
NBP2-26061
BRN3B/POU4F2 Antibody
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, PEP-ELISA
POU4F3 Antibody
(5B8)
H00005459-M01
Western Blot: POU4F3 Antibody (5B8) [H00005459-M01] - POU4F3 monoclonal antibody (M01), clone 5B8 Analysis of POU4F3 expression in Hela S3 NE.
Immunocytochemistry/Immunofluorescence: POU4F3 Antibody (5B8) [H00005459-M01] - Analysis of monoclonal antibody to POU4F3 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: POU4F3 Antibody (5B8) [H00005459-M01] - Analysis of POU4F3 over-expressed 293 cell line, cotransfected with POU4F3 Validated Chimera RNAi ( Cat # H00005459-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with POU4F3 monoclonal antibody (M01), clone 5B8 (Cat # H00005459-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
CXCR7/RDC-1
Antibody
NBP2-24779
Simple Western: CXCR7/RDC-1 Antibody [NBP2-24779] - Simple Western lane view shows a specific band for CXCR7 in 0.5 mg/ml of Jurkat lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunohistochemistry-Paraffin: CXCR7/RDC-1 Antibody [NBP2-24779] - IHC analysis of a formalin fixed paraffin embedded tissue section of human tonsil using 5ug/ml concentration of CXCR7/RDC-1 antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This CXCR7 antibody generated a specific membrane cytoplasmic staining in most of the cells, and the signal was highest/very intense in the endothelial cells/blood vessels.
Immunohistochemistry-Paraffin: CXCR7/RDC-1 Antibody [NBP2-24779] - IHC analysis of a formalin fixed paraffin embedded tissue section of human tonsil using 5ug/ml concentration of CXCR7/RDC-1 antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This CXCR7 antibody generated a specific membrane cytoplasmic staining in most of the cells, and the signal was highest/very intense in the endothelial cells/blood vessels.
(5 Publications)
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P
SNAP25 Antibody
NBP1-88769
Western Blot: SNAP25 Antibody [NBP1-88769] - Analysis in human cell lines U2OS and MCF-7 using anti-SNAP25 antibody. Corresponding SNAP25 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunohistochemistry-Paraffin: SNAP25 Antibody [NBP1-88769] - Staining in human cerebral cortex and pancreas tissues using anti-SNAP25 antibody. Corresponding SNAP25 RNA-seq data are presented for the same tissues.
Western Blot: SNAP25 Antibody [NBP1-88769] - Analysis in human cell line SH-SY5Y.
(4 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
CXCR4 Antibody
(44716) [Unconjugated
MAB172
CXCR4 was detected in immersion fixed paraffin-embedded sections of human spleen using Mouse Anti-Human CXCR4 Monoclonal Antibody (Catalog # MAB172) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Jurkat human acute T cell leukemia cell line was stained with Mouse Anti-Human CXCR4 Monoclonal Antibody (Catalog # MAB172, filled histogram) or isotype control antibody (Catalog # MAB004, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). View our protocol for Staining Membrane-associated Proteins.
CXCR4 was detected in immersion fixed paraffin-embedded sections of human lymph node using 15 µg/mL Human CXCR4 Monoclonal Antibody (Catalog # MAB172) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(38 Publications)
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with scrambled control siRNA (lane 1) or Bcl-2 siRNA (lane2). Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - WB analysis of whole cell lysate (WCL) of Jurkat cells using anti-Bcl-2 antibody (NB100-56098) at 1:1000 dilution. HRP conjugated goat anti-rabbit IgG (H+L) cross adsorbed secondary antibody was used with ECL substrate for the detection of Bcl2 antibody bound to the blotted protein. This Bcl2 antibody detected a specific band at expected molecular weight marker position of Bcl2 protein (26kDa).
Immunohistochemistry-Paraffin: Bcl-2 Antibody [NB100-56098] - IHC analysis of a formalin-fixed paraffin-embedded (FFPE) human breast carcinoma tissue section using 1:1000 dilution of Bcl-2 antibody (NB100-56098) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of BCL2 in the cancer cells with relatively intense signal in their nuclear membranes. Staining was performed by Histowiz.
(2 Reviews)
(6 Publications)
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
TrkA Antibody
[Unconjugated]
AF175
TrkA was detected in immersion fixed paraffin-embedded sections of human colon using Goat Anti-Human TrkA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF175) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit  (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in colon glands. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of RPMI 8226 human multiple myeloma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human TrkA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF175) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for TrkA at approximately 140 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human beta ‑NGF (Catalog # 256-GF) stimulates proliferation in the TF‑1 human erythroleukemic cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human beta ‑NGF (5 ng/mL) is neutralized (green line) by increasing concent­rations of Goat Anti-Human TrkA Antigen Affinity-purified Poly­clonal Antibody (Catalog # AF175). The ND50 is typically3‑12 µg/mL.
(1 Review)
(6 Publications)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
BDNF [Unconjugated]
248-BD
1 μg/lane of Recombinant Human BDNF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human BDNF (Catalog #248‑BD) stimulates cell proliferation in the BaF mouse pro-B cell line transfected with TrkB. The ED50 for this effect is 0.2-2 ng/mL.
(6 Reviews)
(100 Publications)
Species: Hu, Mu, Rt, Ca, Eq
CALCRL Antibody
NLS6731
Immunohistochemistry-Paraffin: CALCRL Antibody [NLS6731] - Anti-CALCRL / CGRP Receptor antibody IHC of human Lung, Non-Small Cell Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: CALCRL Antibody [NLS6731] - Analysis of anti-CALCRL / CGRP Receptor antibody with colon, submucosal plexus and submucosal vessels at 34 ug/ ml.
Immunohistochemistry-Paraffin: CALCRL Antibody [NLS6731] - Analysis of anti-CALCRL / CGRP Receptor antibody with human bone, osteosarcoma.
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
Procalcitonin
Antibody (44d9)
NB120-14817
Procalcitonin Antibody (44d9)
(1 Review)
(3 Publications)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
CXCL12/SDF-1 alpha
[Unconjugated]
350-NS/CF
Recombinant Human/Rhesus Macaque/Feline CXCL12/SDF-1 alpha (Catalog # 350-NS/CF) chemoattracts the BaF3 mouse pro-B cells transfected with human CXCR4. The ED50 for this effect is 0.15-0.6 ng/mL.
1 μg/lane of Recombinant Human/Rhesus Macaque/Feline CXCL12/SDF-1 alpha  was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
(119 Publications)
Species: Hu, Fe, RM
p21/CIP1/CDKN1A
Antibody (WA-1 (HJ21)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(11 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
EN-RAGE/S100A12
Antibody [Unconjugate
AF1052
Western blot shows lysate of human granulocytes. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EN‑RAGE/S100A12 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1052) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EN‑RAGE/S100A12 at approximately 10 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
EN‑RAGE/S100A12 was detected in immersion fixed paraffin-embedded sections of human tonsil using 15 µg/mL Goat Anti-Human EN‑RAGE/S100A12 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1052) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Reviews)
(2 Publications)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Bcl-xL Antibody
NB100-56104
Western Blot: Bcl-xL Antibody [NB100-56104] - Analysis of Bcl-xL in Daoy whole cell lysate using anti-Bcl-xL antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Bcl-Xl Antibody [NB100-56104] - Formalin-fixed paraffin-embedded sections of human epidermis stained for Bcl-X expression using this antibody at the bottom of the images were negative for Bcl-X expression. The adjacent stratum spinosum and middle stratum granulosum layers were both very positive for Bcl-X expression. The top stratum corneum consisting mainly of dead or peeling cells were both negative for Bcl-X expression.
Western Blot: Bcl-Xl Antibody [NB100-56104] - Analysis of Bcl-X in lysates from isolated rat liver mitochondria using this antibody. The antibody detected Bcl-XL at ~30 kDa.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
EGR1 Antibody
(6E8.)
H00001958-M03
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - Analysis of EGR1 expression in transfected 293T cell line by EGR1 monoclonal antibody (M03), clone 6E8. Lane 1: EGR1 transfected lysatE (59.73 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: EGR1 Antibody (6E8) [H00001958-M03] - Analysis of monoclonal antibody to EGR1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: EGR1 Antibody (6E8) [H00001958-M03] - Analysis of monoclonal antibody to EGR1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
(2 Publications)
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
EWSR1 Antibody
NBP2-49020
Western Blot: EWSR1 Antibody [NBP2-49020] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG
Immunocytochemistry/Immunofluorescence: EWSR1 Antibody [NBP2-49020] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49020] - Staining in human testis and skeletal muscle tissues using anti-EWSR1 antibody. Corresponding EWSR1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
BRN3A Antibody
(7B4)
H00005457-M04
BRN3A Antibody (7B4)
Species: Hu
Applications: WB, ELISA

Publications for BRN3A Antibody (H00005457-M04) (0)

There are no publications for BRN3A Antibody (H00005457-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRN3A Antibody (H00005457-M04) (0)

There are no reviews for BRN3A Antibody (H00005457-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRN3A Antibody (H00005457-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for BRN3A Antibody (H00005457-M04)

Discover related pathways, diseases and genes to BRN3A Antibody (H00005457-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRN3A Antibody (H00005457-M04)

Discover more about diseases related to BRN3A Antibody (H00005457-M04).
 

Pathways for BRN3A Antibody (H00005457-M04)

View related products by pathway.

PTMs for BRN3A Antibody (H00005457-M04)

Learn more about PTMs related to BRN3A Antibody (H00005457-M04).

Blogs on BRN3A

There are no specific blogs for BRN3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRN3A Antibody (7B4) and receive a gift card or discount.


Bioinformatics

Gene Symbol POU4F1
Uniprot