BRN3A Antibody (7B4)

Images

 
Western Blot: BRN3A Antibody (7B4) [H00005457-M04] - Analysis of POU4F1 expression in transfected 293T cell line by POU4F1 monoclonal antibody (M04), clone 7B4. Lane 1: POU4F1 transfected lysatE (46.09 KDa). Lane 2: ...read more
ELISA: BRN3A Antibody (7B4) [H00005457-M04] - Detection limit for recombinant GST tagged POU4F1 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
7B4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BRN3A Antibody (7B4) Summary

Immunogen
POU4F1 (NP_006228.2, 331 a.a. - 420 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
POU4F1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BRN3A Antibody (7B4)

  • Brain-3A
  • Brain-specific homeobox/POU domain protein 3A
  • brn-3A
  • BRN3Abrain-3A
  • FLJ13449
  • Homeobox/POU domain protein RDC-1
  • Oct-T1
  • POU class 4 homeobox 1
  • POU domain class 4, transcription factor 1
  • POU domain, class 4, transcription factor 1
  • RDC1
  • RDC-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26061
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, PEP-ELISA
H00005459-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-24779
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NLS6731
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-49020
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005457-M04
Species: Hu
Applications: WB, ELISA

Publications for BRN3A Antibody (H00005457-M04) (0)

There are no publications for BRN3A Antibody (H00005457-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRN3A Antibody (H00005457-M04) (0)

There are no reviews for BRN3A Antibody (H00005457-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRN3A Antibody (H00005457-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for BRN3A Antibody (H00005457-M04)

Discover related pathways, diseases and genes to BRN3A Antibody (H00005457-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRN3A Antibody (H00005457-M04)

Discover more about diseases related to BRN3A Antibody (H00005457-M04).
 

Pathways for BRN3A Antibody (H00005457-M04)

View related products by pathway.

PTMs for BRN3A Antibody (H00005457-M04)

Learn more about PTMs related to BRN3A Antibody (H00005457-M04).

Blogs on BRN3A

There are no specific blogs for BRN3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRN3A Antibody (7B4) and receive a gift card or discount.

Bioinformatics

Gene Symbol POU4F1
Uniprot