Bradykinin RB2/BDKRB2 Antibody (3F6)

Images

 
ELISA: Bradykinin RB2/BDKRB2 Antibody (3F6) [H00000624-M01] - Detection limit for recombinant GST tagged BDKRB2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Bradykinin RB2/BDKRB2 Antibody (3F6) Summary

Immunogen
BDKRB2 (NP_000614, 1 a.a. - 60 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
Specificity
BDKRB2 - bradykinin receptor B2
Isotype
IgG1 Lambda
Clonality
Monoclonal
Host
Mouse
Gene
BDKRB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Bradykinin RB2/BDKRB2 Antibody (3F6)

  • B2 bradykinin receptor
  • B2R
  • BDKRB2
  • BK-2 receptor
  • BK2
  • BK-2
  • BKR2
  • Bradykinin RB2
  • bradykinin receptor B2
  • BradykininRB2
  • BRB2
  • DKFZp686O088

Background

This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1396
Species: Hu
Applications: WB
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
NBP1-77078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu

Publications for Bradykinin RB2/BDKRB2 Antibody (H00000624-M01) (0)

There are no publications for Bradykinin RB2/BDKRB2 Antibody (H00000624-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bradykinin RB2/BDKRB2 Antibody (H00000624-M01) (0)

There are no reviews for Bradykinin RB2/BDKRB2 Antibody (H00000624-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Bradykinin RB2/BDKRB2 Antibody (H00000624-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Bradykinin RB2/BDKRB2 Products

Bioinformatics Tool for Bradykinin RB2/BDKRB2 Antibody (H00000624-M01)

Discover related pathways, diseases and genes to Bradykinin RB2/BDKRB2 Antibody (H00000624-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Bradykinin RB2/BDKRB2 Antibody (H00000624-M01)

Discover more about diseases related to Bradykinin RB2/BDKRB2 Antibody (H00000624-M01).
 

Pathways for Bradykinin RB2/BDKRB2 Antibody (H00000624-M01)

View related products by pathway.

PTMs for Bradykinin RB2/BDKRB2 Antibody (H00000624-M01)

Learn more about PTMs related to Bradykinin RB2/BDKRB2 Antibody (H00000624-M01).
 

Research Areas for Bradykinin RB2/BDKRB2 Antibody (H00000624-M01)

Find related products by research area.

Blogs on Bradykinin RB2/BDKRB2

There are no specific blogs for Bradykinin RB2/BDKRB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Bradykinin RB2/BDKRB2 Antibody (3F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol BDKRB2
Entrez
OMIM
Uniprot