Bradykinin RB2/BDKRB2 Antibody (3F6) - Azide and BSA Free

ELISA: Bradykinin RB2/BDKRB2 Antibody (3F6) [H00000624-M01] - Detection limit for recombinant GST tagged BDKRB2 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, Flow, Func
• Clone: 3F6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Bradykinin RB2/BDKRB2 Antibody (3F6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: BDKRB2 (NP_000614, 1 a.a. ~ 60 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
• Specificity: BDKRB2 - bradykinin receptor B2
• Isotype: IgG1 Lambda
• Clonality: Monoclonal
• Host: Mouse
• Gene: BDKRB2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Flow Cytometry
  • Functional
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Bradykinin RB2/BDKRB2 Antibody (3F6) - Azide and BSA Free

• B2 bradykinin receptor
• B2R
• BDKRB2
• BK-2 receptor
• BK2
• BK-2
• BKR2
• Bradykinin RB2
• bradykinin receptor B2
• BradykininRB2
• BRB2
• DKFZp686O088

Background

This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Bradykinin RB2/BDKRB2 Antibody (H00000624-M01)(2)

Publications using H00000624-M01

• Gu J, Al-Bayati K, Ho EA. Development of antibody-modified chitosan nanoparticles for the targeted delivery of siRNA across the blood-brain barrier as a strategy for inhibiting HIV replication in astrocytes. Drug Deliv Transl Res 2017-03-17 [PMID: 28315051]
• Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01

Bioinformatics

• Gene Symbol: BDKRB2
• Entrez:
  • 624(Human)
• OMIM:
  • 113503(Human)
• Uniprot:
  • NP_000614()