BPTF/FALZ Recombinant Protein Antigen

Images

 
There are currently no images for BPTF/FALZ Recombinant Protein Antigen (NBP2-57567PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BPTF/FALZ Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BPTF/FALZ.

Source: E. coli

Amino Acid Sequence: TTIASTGQTFQITGNPVTMAGKVITKLPLPANSKIVAVNVPATQGGIVQVHQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BPTF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57567.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BPTF/FALZ Recombinant Protein Antigen

  • BPTF
  • BPTF/FALZ
  • bromodomain and PHD domain transcription factor
  • Bromodomain and PHD finger-containing transcription factor
  • bromodomain PHD finger transcription factor
  • EC 3.6.1
  • EC 6.2.1.5
  • FAC1
  • FAC1fetal Alz-50 reactive clone 1
  • FALZ
  • FALZnucleosome-remodeling factor subunit BPTF
  • Fetal Alz-50 clone 1 protein
  • Fetal Alzheimer antigennucleosome remodeling factor, large subunit
  • NURF301

Background

FALZ/BPTF is a histone-binding component of NURF (nucleosome remodeling factor), a complex that catalyzes ATP-dependent nucleosome sliding and facilitates transcription of chromatin. This gene was identified in brain homogenates from patients with Alzheimer's disease. Analysis of the original protein (fetal Alz-50 reactive clone 1, or FAC1), containing a DNA-binding domain, a zinc finger motif, and a C-terminal bromodomain, suggested it might play a role in the regulation of transcription during proliferation. High levels of FAC1 were detected in fetal brain and in patients with neurodegenerative diseases. This protein is highly similar to the largest subunit of the Drosophila NURF (nucleosome remodeling factor) complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
NB100-55310
Species: Hu, Mu
Applications: IP, WB
MAB3024
Species: Hu, Mu, Rt
Applications: KO, Simple Western, WB
NBP1-32105
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-25162
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
NB100-86984
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, KD, WB
AF2818
Species: Hu
Applications: ICC, WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NB100-60411
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IP, KD, KO, WB
NBP3-05514
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1762
Species: Hu, Mu, Pm
Applications: ChIP, ELISA, IHC, IHC-P, KD, Simple Western, WB
NBP2-88046
Species: Hu
Applications: WB
NBP1-78100
Species: Hu
Applications: ELISA, WB
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP3-16797
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-57567PEP
Species: Hu
Applications: AC

Publications for BPTF/FALZ Recombinant Protein Antigen (NBP2-57567PEP) (0)

There are no publications for BPTF/FALZ Recombinant Protein Antigen (NBP2-57567PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BPTF/FALZ Recombinant Protein Antigen (NBP2-57567PEP) (0)

There are no reviews for BPTF/FALZ Recombinant Protein Antigen (NBP2-57567PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BPTF/FALZ Recombinant Protein Antigen (NBP2-57567PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am interesting by anti-BPTF antibody. I would like to know if a large protein like that could be revealed in PVDF membrane?
    • Regarding your question, nucleosome-remodeling factor subunit (BPTF) is a very large protein as you have also mentioned (338KD). There are some tips for efficient transfer of these proteins in western blot for instance: 1) Make sure to use a low percentage gel, for BPTF in particular I suggest you use 7% gel or even lower (5%). 2) You can use either Nitrocellulose or PVDF, to my knowledge the binding efficiency is higher for nitrocellulose while PVDF is a better choice of membrane if you are planning to do re-probing and stripping. If you are going to use PVDF, make sure to wet it in 100% methanol before use. Furthermore, PVDF membrane exhibits better binding efficiency of electroblotted material in the presence of SDS in the transfer buffer. However SDS added to facilitate transfer of large proteins should not exceed 0.05% as it will interfere with the binding of the protein to the membrane. 3) For transfer you can either use the semi-dry or wet transfer but you decide doing wet transfer, I strongly recommend you doing the transfer in low voltage (at 50v) for instance in order to obtain an efficient transfer. These are some suggestions I can provide for a better and more efficient transfer for large proteins like BPTF.

Additional BPTF/FALZ Products

Blogs on BPTF/FALZ

There are no specific blogs for BPTF/FALZ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BPTF/FALZ Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BPTF