BMAL1 Recombinant Protein Antigen

Images

 
There are currently no images for BMAL1 Recombinant Protein Antigen (NBP2-56754PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BMAL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BMAL1.

Source: E. coli

Amino Acid Sequence: SSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BMAL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56754.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BMAL1 Recombinant Protein Antigen

  • ARNTL
  • aryl hydrocarbon receptor nuclear translocator-like protein 1
  • aryl hydrocarbon receptor nuclear translocator-like
  • basic-helix-loop-helix-PAS orphan MOP3
  • BHLHE5
  • bHLHe5brain and muscle
  • bHLH-PAS protein JAP3
  • BMAL1
  • BMAL1c
  • BMAL1TIC
  • Brain and muscle ARNT-like 1
  • Class E basic helix-loop-helix protein 5
  • JAP3
  • Member of PAS protein 3
  • member of PAS superfamily 3
  • MOP3
  • MOP3BMAL1c
  • PAS domain-containing protein 3
  • PASD3
  • PASD3MGC47515
  • TIC

Background

Aryl hydrocarbon receptor nuclear translocator-like (ARNTL), also known as Bmal1 or Mop3 is a major component of the circadian clock oscillator. Specifically, BMAL-1 acts as a general dimerization partner for a subset of the bHLH-PAS (basic-helix-loop-helix-PER-ARNT-SIM) superfamily of transcription regulators, is involved in circadian rhythm generation. BMAL 1 interacts with MOP4, CLOCK, Hypoxia-inducible factor-1 alpha and -2 alpha. This interaction appears to be distinct from that of the more characterized general partner, ARNT (HIF-1Beta).

BMAL1 is highly expressed in the adult brain, skeletal muscle and heart, and has been associated with hypertension and type 2 diabetes. Because of its role in the circadian clock oscillator, BMAL-1 is also thought to be invloven seasonal affective disorder. Therefore, BMAL1 antibodies are useful for circadian studies as well as heart and brain research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-125
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-24589
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, Simple Western, WB
NB100-126
Species: Hu, Mu
Applications: ChIP, WB
NBP3-12196
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
AF3764
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-00749
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-25721
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-22439
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP2-02710
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-83997
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-88027
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
NBP1-86436
Species: Hu
Applications: IHC, IHC-P
NBP1-88612
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009572-M02
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, KD, WB
664-LI
Species: Hu
Applications: BA
NB100-1800
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP2-56754PEP
Species: Hu
Applications: AC

Publications for BMAL1 Recombinant Protein Antigen (NBP2-56754PEP) (0)

There are no publications for BMAL1 Recombinant Protein Antigen (NBP2-56754PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMAL1 Recombinant Protein Antigen (NBP2-56754PEP) (0)

There are no reviews for BMAL1 Recombinant Protein Antigen (NBP2-56754PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BMAL1 Recombinant Protein Antigen (NBP2-56754PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BMAL1 Products

Research Areas for BMAL1 Recombinant Protein Antigen (NBP2-56754PEP)

Find related products by research area.

Blogs on BMAL1

There are no specific blogs for BMAL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BMAL1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BMAL1