BMAL1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BMAL1. Source: E. coli Amino Acid Sequence: SSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
BMAL1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56754. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for BMAL1 Recombinant Protein Antigen
Background
Aryl hydrocarbon receptor nuclear translocator-like (ARNTL), also known as Bmal1 or Mop3 is a major component of the circadian clock oscillator. Specifically, BMAL-1 acts as a general dimerization partner for a subset of the bHLH-PAS (basic-helix-loop-helix-PER-ARNT-SIM) superfamily of transcription regulators, is involved in circadian rhythm generation. BMAL 1 interacts with MOP4, CLOCK, Hypoxia-inducible factor-1 alpha and -2 alpha. This interaction appears to be distinct from that of the more characterized general partner, ARNT (HIF-1Beta).
BMAL1 is highly expressed in the adult brain, skeletal muscle and heart, and has been associated with hypertension and type 2 diabetes. Because of its role in the circadian clock oscillator, BMAL-1 is also thought to be invloven seasonal affective disorder. Therefore, BMAL1 antibodies are useful for circadian studies as well as heart and brain research.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, WB
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: AC
Publications for BMAL1 Recombinant Protein Antigen (NBP2-56754PEP) (0)
There are no publications for BMAL1 Recombinant Protein Antigen (NBP2-56754PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for BMAL1 Recombinant Protein Antigen (NBP2-56754PEP) (0)
There are no reviews for BMAL1 Recombinant Protein Antigen (NBP2-56754PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for BMAL1 Recombinant Protein Antigen (NBP2-56754PEP) (0)
Additional BMAL1 Products
Research Areas for BMAL1 Recombinant Protein Antigen (NBP2-56754PEP)
Find related products by research area.
|
Blogs on BMAL1