Blk Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Blk. Source: E. coli
Amino Acid Sequence: YTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWF Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
BLK |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68887. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Blk Recombinant Protein Antigen
Background
BLK ( B lymphoid tyrosine kinase), with 505-amino acid protein (about 56KDa), belongs to the Src non-receptor tyrosine kinases family.Different subcellular localizations of Src-family kinases may be important for the regulation of specific cellular processes such as mitogenesis, cytoskeletal organization, and membrane trafficking.Blk is expressed exclusively by B lymphocytes and it is thought to function in a signal transductory pathway specific to this lineage. B lymphoid expression of an active Blk mutant caused proliferation of B progenitor cells and enhanced responsiveness of these cells to interleukin 7. Thus, sustained activation of Blk induces responses normally associated with the pre-BCR.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, Flow, KD, PEP-ELISA, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC, IHC, mIF, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Publications for Blk Recombinant Protein Antigen (NBP2-68887PEP) (0)
There are no publications for Blk Recombinant Protein Antigen (NBP2-68887PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Blk Recombinant Protein Antigen (NBP2-68887PEP) (0)
There are no reviews for Blk Recombinant Protein Antigen (NBP2-68887PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Blk Recombinant Protein Antigen (NBP2-68887PEP) (0)
Additional Blk Products
Research Areas for Blk Recombinant Protein Antigen (NBP2-68887PEP)
Find related products by research area.
|
Blogs on Blk