BIVM Antibody

Images

 
Immunohistochemistry-Paraffin: BIVM Antibody [NBP2-14354] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BIVM Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RSNDSGNGEHKSERKSPEENLQGAVKSFCTSASGAPLGPKGDGHYPWSCP VTHTREKIYAICSDYAFLNQATSIYKTPNPSRSPCLPDSTSLSAGNNSSR Y
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BIVM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BIVM Protein (NBP2-14354PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BIVM Antibody

  • basic immunoglobulin-like variable motif-containing protein
  • basic, immunoglobulin-like variable motif containing
  • FLJ20159
  • FLJ44301
  • FLJ44556
  • MGC133326

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97469
Species: Hu, Mu, Rt, Av, Ch, In, Ma, Pl, Pm, Ye
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-92538
Species: Hu
Applications: WB, IHC, IHC-P
AF6199
Species: Hu
Applications: WB
H00007290-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-98506
Species: Mu
Applications: WB
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP1-88825
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-22513
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85861
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89611
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31606
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45514
Species: Hu
Applications: WB, IHC
NBP2-45677
Species: Hu, Mk
Applications: WB, IHC

Publications for BIVM Antibody (NBP2-14354) (0)

There are no publications for BIVM Antibody (NBP2-14354).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BIVM Antibody (NBP2-14354) (0)

There are no reviews for BIVM Antibody (NBP2-14354). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BIVM Antibody (NBP2-14354) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BIVM Products

Bioinformatics Tool for BIVM Antibody (NBP2-14354)

Discover related pathways, diseases and genes to BIVM Antibody (NBP2-14354). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BIVM Antibody (NBP2-14354)

Discover more about diseases related to BIVM Antibody (NBP2-14354).

Research Areas for BIVM Antibody (NBP2-14354)

Find related products by research area.

Blogs on BIVM

There are no specific blogs for BIVM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BIVM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BIVM