BHLHB5 Antibody - BSA Free

Western Blot: BHLHB5 Antibody [NBP3-10296] - Western blot analysis using NBP3-10296 on Human Jurkat as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

BHLHB5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BHLHB5 Antibody - BSA Free (NBP3-10296) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BHLHB5 (NP_689627). Peptide sequence LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPR
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BHLHE22
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for BHLHB5 Antibody - BSA Free

• Basic Helix-Loop-Helix Domain Containing, Class B, 5
• basic helix-loop-helix family, member e22
• Beta3
• BHLHE22
• CAGL85
• Class B Basic Helix-Loop-Helix Protein 5
• Class E Basic Helix-Loop-Helix Protein 22
• TNRC20
• Trinucleotide Repeat Containing 20
• Trinucleotide Repeat-Containing Gene 20 Protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BHLHE22