Begain Antibody

Images

 
Western Blot: Begain Antibody [NBP1-82907] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: Begain Antibody [NBP1-82907] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Begain Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRPLSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDLSQGHLAEPCFLRAGGDLSLSPGRSADPLPGYAPSE
Specificity
Specificity of human Begain antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BEGAIN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Begain Protein (NBP1-82907PEP)
Publications
Read Publication using NBP1-82907.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Begain Antibody

  • brain-enriched guanylate kinase-associated homolog (rat)
  • KIAA1446brain-enriched guanylate kinase-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, ICC
H00005662-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, ICC
MAB1144
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-76911
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-06579
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-91684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00004068-M01
Species: Hu
Applications: WB, ELISA
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl
NBP2-57704
Species: Hu
Applications: ICC/IF
NBP1-93467
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-82907
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Begain Antibody (NBP1-82907)(1)

Reviews for Begain Antibody (NBP1-82907) (0)

There are no reviews for Begain Antibody (NBP1-82907). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Begain Antibody (NBP1-82907) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Begain Antibody (NBP1-82907)

Discover related pathways, diseases and genes to Begain Antibody (NBP1-82907). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Begain Antibody (NBP1-82907)

Discover more about diseases related to Begain Antibody (NBP1-82907).
 

Pathways for Begain Antibody (NBP1-82907)

View related products by pathway.

PTMs for Begain Antibody (NBP1-82907)

Learn more about PTMs related to Begain Antibody (NBP1-82907).

Blogs on Begain

There are no specific blogs for Begain, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Begain Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BEGAIN