BCL9-2 Recombinant Protein Antigen

Images

 
There are currently no images for BCL9-2 Recombinant Protein Antigen (NBP2-55060PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BCL9-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BCL9-2.

Source: E.coli

Amino Acid Sequence: MGMEFGGGRGLLSPPMGQSGLREVDPPMGPGNLNMNMNVNMNMNMNLNVQMTPQQQMLMSQKMRGPGDLMGPQGLSPEEMARVRAQNSSGVMGGPQKMLMP

Protein/Peptide Type
Recombinant Protein Antigen
Gene
BCL9L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55060 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BCL9-2 Recombinant Protein Antigen

  • B-cell CLL/lymphoma 9-like protein
  • B-cell CLL/lymphoma 9-like
  • B-cell lymphoma 9-like protein
  • Bcl92
  • Bcl9-2
  • BCL9-like protein
  • DLNB11
  • DLNB11BCL9-2
  • nuclear co-factor of beta-catenin signalling
  • Protein BCL9-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3996
Species: Hu
Applications: WB
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB3616
Species: Hu
Applications: WB, Simple Western, IHC, ICC
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00283150-Q01
Species: Hu
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
AF4885
Species: Mu
Applications: WB, IP
MAB190
Species: Hu
Applications: Flow, IHC, CyTOF-reported, ICC, Neut
MAB3617
Species: Hu, Mu
Applications: WB
NBP2-14401
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90450
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
AF3445
Species: Mu
Applications: WB, IHC
NBP1-91875
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55060PEP
Species: Hu
Applications: AC

Publications for BCL9-2 Recombinant Protein Antigen (NBP2-55060PEP) (0)

There are no publications for BCL9-2 Recombinant Protein Antigen (NBP2-55060PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCL9-2 Recombinant Protein Antigen (NBP2-55060PEP) (0)

There are no reviews for BCL9-2 Recombinant Protein Antigen (NBP2-55060PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for BCL9-2 Recombinant Protein Antigen (NBP2-55060PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BCL9-2 Products

Bioinformatics Tool for BCL9-2 Recombinant Protein Antigen (NBP2-55060PEP)

Discover related pathways, diseases and genes to BCL9-2 Recombinant Protein Antigen (NBP2-55060PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCL9-2 Recombinant Protein Antigen (NBP2-55060PEP)

Discover more about diseases related to BCL9-2 Recombinant Protein Antigen (NBP2-55060PEP).
 

Pathways for BCL9-2 Recombinant Protein Antigen (NBP2-55060PEP)

View related products by pathway.

PTMs for BCL9-2 Recombinant Protein Antigen (NBP2-55060PEP)

Learn more about PTMs related to BCL9-2 Recombinant Protein Antigen (NBP2-55060PEP).

Blogs on BCL9-2

There are no specific blogs for BCL9-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BCL9-2 Antibody
NBP2-14350
BCL9-2 Antibody
NBP2-14350
BCL9-2 Antibody
NBP2-14350

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BCL9-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL9L
Entrez