Recombinant Human BCL9-2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BCL9-2 Protein Summary

Description
BCL9-2 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NQIQRVPGFGGMQSMPMEVPMNAMQRPVRPGMGWTEDLPPMGGPSNFAQNTMPYPGGQGEAERFMTPRVREELLRHQLLEKRSMGMQRPLGMAGSGMGQSMEMERMMQAH
Protein/Peptide Type
Partial Recombinant Protein
Gene
BCL9L

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BCL9-2 Protein

  • B-cell CLL/lymphoma 9-like protein
  • B-cell CLL/lymphoma 9-like
  • B-cell lymphoma 9-like protein
  • Bcl92
  • Bcl9-2
  • BCL9-like protein
  • DLNB11
  • DLNB11BCL9-2
  • nuclear co-factor of beta-catenin signalling
  • Protein BCL9-2

Background

BCL9L - B-cell CLL/lymphoma 9-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3996
Species: Hu
Applications: WB
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB3616
Species: Hu
Applications: WB, Simple Western, IHC, ICC
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00283150-Q01
Species: Hu
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
AF4885
Species: Mu
Applications: WB, IP
MAB190
Species: Hu
Applications: Flow, IHC, CyTOF-reported, ICC, Neut
MAB3617
Species: Hu, Mu
Applications: WB
NBP2-14401
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90450
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
AF3445
Species: Mu
Applications: WB, IHC
NBP1-91875
Species: Hu
Applications: WB, IHC, IHC-P
H00283149-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for BCL9-2 Partial Recombinant Protein (H00283149-Q01) (0)

There are no publications for BCL9-2 Partial Recombinant Protein (H00283149-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCL9-2 Partial Recombinant Protein (H00283149-Q01) (0)

There are no reviews for BCL9-2 Partial Recombinant Protein (H00283149-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BCL9-2 Partial Recombinant Protein (H00283149-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BCL9-2 Products

Bioinformatics Tool for BCL9-2 Partial Recombinant Protein (H00283149-Q01)

Discover related pathways, diseases and genes to BCL9-2 Partial Recombinant Protein (H00283149-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCL9-2 Partial Recombinant Protein (H00283149-Q01)

Discover more about diseases related to BCL9-2 Partial Recombinant Protein (H00283149-Q01).
 

Pathways for BCL9-2 Partial Recombinant Protein (H00283149-Q01)

View related products by pathway.

PTMs for BCL9-2 Partial Recombinant Protein (H00283149-Q01)

Learn more about PTMs related to BCL9-2 Partial Recombinant Protein (H00283149-Q01).

Blogs on BCL9-2

There are no specific blogs for BCL9-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BCL9-2 Antibody
NBP2-14350
BCL9-2 Antibody
NBP2-14350
BCL9-2 Antibody
NBP2-14350

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BCL9-2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL9L
Entrez