Bcl G Recombinant Protein Antigen

Images

 
There are currently no images for Bcl G Protein (NBP1-91697PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Bcl G Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BCL2L14.

Source: E. coli

Amino Acid Sequence: GQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BCL2L14
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91697.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Bcl G Recombinant Protein Antigen

  • apoptosis facilitator Bcl-2-like protein 14
  • Apoptosis regulator Bcl-G
  • Bcl2-L-14
  • BCL2-like 14 (apoptosis facilitator)
  • BCL-G
  • BCLGbcl2-L-14

Background

Members in the Bcl-2 family are critical regulators of apoptosis by either inhibiting or promoting cell death. Bcl-2 homology 3 (BH3) domain is a potent death domain. BH3 domain containing pro-apoptotic proteins, including Bad, Bax, Bid, Bik, and Hrk, form a growing subclass of the Bcl-2 family. A novel BH3 domain containing protein was recently identified and designated Bcl-G. The mRNA of Bcl-G encodes 2 isoforms, Bcl-GL, which is widely expressed in multiple tissues, and Bcl-GS, which is only found in testis. The Bcl-GS protein is predominantly localized to cytoplasmic organelles whereas Bcl-GL was distributed throughout the cytosol. Overexpression of either protein induced apoptosis, although Bcl-GS was far more potent than Bcl-GS. Apoptosis induction was dependent on the BH3 domain and could be suppressed by co-expression with the anti-apoptotic Bcl-XL protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB9036
Species: Hu
Applications: ICC, WB
AF4820
Species: Hu
Applications: IHC, WB
NBP2-24501
Species: Bv, Hu, Mu, Pm
Applications: IHC,  IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
MAB6405
Species: Hu
Applications: ICC, IHC, KO, WB
NB120-495
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
DTSP10
Species: Hu
Applications: ELISA
MAB1505
Species: Hu
Applications: CyTOF-ready, Flow, ICC
DNST0
Species: Hu
Applications: ELISA
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
AF860
Species: Hu, Mu
Applications: IP, Simple Western, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-76658
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP1-85884
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-91697PEP
Species: Hu
Applications: AC

Publications for Bcl G Protein (NBP1-91697PEP) (0)

There are no publications for Bcl G Protein (NBP1-91697PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bcl G Protein (NBP1-91697PEP) (0)

There are no reviews for Bcl G Protein (NBP1-91697PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Bcl G Protein (NBP1-91697PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Bcl G Products

Research Areas for Bcl G Protein (NBP1-91697PEP)

Find related products by research area.

Blogs on Bcl G

There are no specific blogs for Bcl G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Bcl G Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL2L14