Bcl-6 Recombinant Protein Antigen

Images

 
There are currently no images for Bcl-6 Recombinant Protein Antigen (NBP2-59786PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Bcl-6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Bcl-6

Source: E.coli

Amino Acid Sequence: NIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BCL6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-59786. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Bcl-6 Recombinant Protein Antigen

  • B-cell CLL/lymphoma 6
  • B-cell lymphoma 6 protein transcript
  • Bcl-5
  • BCL5B-cell lymphoma 5 protein
  • Bcl6
  • Bcl-6
  • BCL6A
  • cys-his2 zinc finger transcription factor
  • LAZ3
  • LAZ3ZBTB27B-cell lymphoma 6 protein
  • lymphoma-associated zinc finger gene on chromosome 3
  • Protein LAZ-3
  • ZBTB27
  • Zinc finger and BTB domain-containing protein 27
  • Zinc finger protein 51ZNF51
  • zinc finger transcription factor BCL6S
  • ZNF51

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AF5525
Species: Hu
Applications: IHC, WB
NBP1-47396
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB600-235
Species: Hu, Mu, Po
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF2780
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
NBP2-70360
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC, IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
594-ML/CF
Species: Mu
Applications: BA
H00002629-M01
Species: Hu, Pl
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP2-59786PEP
Species: Hu
Applications: AC

Publications for Bcl-6 Recombinant Protein Antigen (NBP2-59786PEP) (0)

There are no publications for Bcl-6 Recombinant Protein Antigen (NBP2-59786PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bcl-6 Recombinant Protein Antigen (NBP2-59786PEP) (0)

There are no reviews for Bcl-6 Recombinant Protein Antigen (NBP2-59786PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Bcl-6 Recombinant Protein Antigen (NBP2-59786PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Bcl-6 Products

Bioinformatics Tool for Bcl-6 Recombinant Protein Antigen (NBP2-59786PEP)

Discover related pathways, diseases and genes to Bcl-6 Recombinant Protein Antigen (NBP2-59786PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Bcl-6 Recombinant Protein Antigen (NBP2-59786PEP)

Discover more about diseases related to Bcl-6 Recombinant Protein Antigen (NBP2-59786PEP).
 

Pathways for Bcl-6 Recombinant Protein Antigen (NBP2-59786PEP)

View related products by pathway.

PTMs for Bcl-6 Recombinant Protein Antigen (NBP2-59786PEP)

Learn more about PTMs related to Bcl-6 Recombinant Protein Antigen (NBP2-59786PEP).
 

Research Areas for Bcl-6 Recombinant Protein Antigen (NBP2-59786PEP)

Find related products by research area.

Blogs on Bcl-6

There are no specific blogs for Bcl-6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Bcl-6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL6