Recombinant Human BARD1 Protein

Images

 
SDS-Page: Recombinant Human BARD1 Protein [H00000580-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BARD1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human BARD1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BARD1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BARD1 Protein

  • BARD-1
  • BRCA1 associated RING domain 1
  • BRCA1-associated RING domain gene 1
  • BRCA1-associated RING domain protein 1
  • EC 6.3.2.-

Background

BARD1 - BRCA1 associated RING domain 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
MAB2476
Species: Hu
Applications: WB, IHC
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NBP1-76831
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87156
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC

Publications for BARD1 Partial Recombinant Protein (H00000580-Q01) (0)

There are no publications for BARD1 Partial Recombinant Protein (H00000580-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BARD1 Partial Recombinant Protein (H00000580-Q01) (0)

There are no reviews for BARD1 Partial Recombinant Protein (H00000580-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BARD1 Partial Recombinant Protein (H00000580-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BARD1 Products

Bioinformatics Tool for BARD1 Partial Recombinant Protein (H00000580-Q01)

Discover related pathways, diseases and genes to BARD1 Partial Recombinant Protein (H00000580-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BARD1 Partial Recombinant Protein (H00000580-Q01)

Discover more about diseases related to BARD1 Partial Recombinant Protein (H00000580-Q01).
 

Pathways for BARD1 Partial Recombinant Protein (H00000580-Q01)

View related products by pathway.

PTMs for BARD1 Partial Recombinant Protein (H00000580-Q01)

Learn more about PTMs related to BARD1 Partial Recombinant Protein (H00000580-Q01).
 

Research Areas for BARD1 Partial Recombinant Protein (H00000580-Q01)

Find related products by research area.

Blogs on BARD1

There are no specific blogs for BARD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Nbs1 Antibody
NB100-143
BARD1 Antibody
NB100-319
Mre11 Antibody
NB100-142

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BARD1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BARD1