BAP1 Antibody

Images

 
Western Blot: BAP1 Antibody [NBP1-83149] - Analysis in control (vector only transfected HEK293T lysate) and bAP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: BAP1 Antibody [NBP1-83149] - Staining of human pancreas shows distinct nucleolar positivity in exocrine cells.

Product Details

Summary
Product Discontinued
View other related BAP1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83149
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

BAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EPYHDIRFNLMAVVPDRRIKYEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSASNKSPLVLEANRA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BAP1 Antibody

  • BAP1
  • BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
  • BRCA1-associated protein 1
  • Cerebral protein 6
  • cerebral protein-13
  • Cerebral Protein-6
  • DKFZp686N04275
  • EC 3.4.19.12
  • FLJ35406
  • FLJ37180
  • hucep-6
  • KIAA0272HUCEP-13
  • ubiquitin carboxyl-terminal hydrolase BAP1
  • ubiquitin carboxy-terminal hydrolase
  • UCHL2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6008
Species: Hu, Mu, Rt
Applications: WB
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-84309
Species: Hu
Applications: WB, IHC, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA
NB100-319
Species: Hu
Applications: WB, IP, PLA
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-79833
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-02377
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-57955
Species: Hu
Applications: WB, ICC/IF
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-83149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for BAP1 Antibody (NBP1-83149) (0)

There are no publications for BAP1 Antibody (NBP1-83149).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAP1 Antibody (NBP1-83149) (0)

There are no reviews for BAP1 Antibody (NBP1-83149). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAP1 Antibody (NBP1-83149) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BAP1 Products

Bioinformatics Tool for BAP1 Antibody (NBP1-83149)

Discover related pathways, diseases and genes to BAP1 Antibody (NBP1-83149). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAP1 Antibody (NBP1-83149)

Discover more about diseases related to BAP1 Antibody (NBP1-83149).
 

Pathways for BAP1 Antibody (NBP1-83149)

View related products by pathway.

PTMs for BAP1 Antibody (NBP1-83149)

Learn more about PTMs related to BAP1 Antibody (NBP1-83149).
 

Research Areas for BAP1 Antibody (NBP1-83149)

Find related products by research area.

Blogs on BAP1

There are no specific blogs for BAP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BAP1
Entrez
Uniprot