BAP1 Antibody

Product Discontinued

BAP1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EPYHDIRFNLMAVVPDRRIKYEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSASNKSPLVLEANRA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BAP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BAP1 Antibody

• BAP1
• BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
• BRCA1-associated protein 1
• Cerebral protein 6
• cerebral protein-13
• Cerebral Protein-6
• DKFZp686N04275
• EC 3.4.19.12
• FLJ35406
• FLJ37180
• hucep-6
• KIAA0272HUCEP-13
• ubiquitin carboxyl-terminal hydrolase BAP1
• ubiquitin carboxy-terminal hydrolase
• UCHL2

Background

BRCA1-associated protein 1 (BAP1) is a ubiquitin hydrolase that acts as a BRCA1 growth control pathway tumor suppressor. Specifically, BAP-1 localizes to the nucleus where it interferes with the BRCA1/BARD1 heterodimer activity and mediates deubiquitination of histone H2A and HCFC1. BAP 1 is highly expressed in testis, placenta, breast and ovary.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BAP1
• Entrez:
  • 8314(Human)
• Uniprot:
  • Q92560(Human)