BANF1 Antibody (M2) - Azide and BSA Free

Western Blot: BANF1 Antibody (M2) [H00008815-M07] - Analysis of BANF1 expression in Raw 264.7.

Immunocytochemistry/Immunofluorescence: BANF1 Antibody (M2) [H00008815-M07] - Analysis of monoclonal antibody to BANF1 on HeLa cell. Antibody concentration 10 ug/ml

Western Blot: BANF1 Antibody (M2) [H00008815-M07] - Analysis of BANF1 expression in PC-12.

Western Blot: BANF1 Antibody (M2) [H00008815-M07] - Analysis of BANF1 expression in Jurkat.

ELISA: BANF1 Antibody (M2) [H00008815-M07] - Detection limit for recombinant GST tagged BANF1 is approximately 10ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IP
• Clone: M2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

BANF1 Antibody (M2) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: BANF1 (AAH05942, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
• Specificity: BANF1 - barrier to autointegration factor 1
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: BANF1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunoprecipitation
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BANF1 Antibody (M2) - Azide and BSA Free

• BAFMGC111161
• BANF1
• barrier to autointegration factor 1
• barrier-to-autointegration factor
• BCRG1
• BCRP1
• Breakpoint cluster region protein 1
• D14S1460

Background

The protein encoded by this gene was identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The endogenous function of the protein is unknown. The protein forms a homodimer which localizes to the nucleus and is specifically associated with chromosomes during mitosis. This protein binds to DNA in a non-specific manner and studies in rodents suggest that it also binds to lamina-associated polypeptide 2, a component of the nuclear lamina.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BANF1 Antibody (H00008815-M07)(3)

Publications using H00008815-M07

• Filipczak D, Souchet A, Georgiou K, Foisner R et Al. Lamin chromatin binding is modulated by interactions of different LAP2? domains with lamins and chromatin iScience 2024-09-25 [PMID: 39319273]
• JH Ahn, MG Cho, S Sohn, JH Lee Inhibition of PP2A activity by H2O2 during mitosis disrupts nuclear envelope reassembly and alters nuclear shape Exp. Mol. Med., 2019-06-05;51(6):64. 2019-06-05 [PMID: 31164634]
• Suzuki Y, Ogawa K, Koyanagi Y, Suzuki Y. Functional Disruption of the Moloney Murine Leukemia Virus Preintegration Complex by Vaccinia-related Kinases. J Biol Chem. 2010-05-28 [PMID: 20511217]

Bioinformatics

• Gene Symbol: BANF1
• Entrez:
  • 8815(Human)
• OMIM:
  • 603811(Human)
• Uniprot:
  • AAH05942(Human)