BANF1 Antibody (M2) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
BANF1 (AAH05942, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL |
| Specificity |
BANF1 - barrier to autointegration factor 1 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
BANF1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunoprecipitation
- Western Blot
|
| Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
| Publications |
|
Reactivity Notes
Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for BANF1 Antibody (M2) - Azide and BSA Free
Background
The protein encoded by this gene was identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The endogenous function of the protein is unknown. The protein forms a homodimer which localizes to the nucleus and is specifically associated with chromosomes during mitosis. This protein binds to DNA in a non-specific manner and studies in rodents suggest that it also binds to lamina-associated polypeptide 2, a component of the nuclear lamina.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC, KO, Simple Western, WB
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Publications for BANF1 Antibody (H00008815-M07)(3)
Showing Publications 1 -
3 of 3.
| Publications using H00008815-M07 |
Applications |
Species |
| Filipczak D, Souchet A, Georgiou K, Foisner R et Al. Lamin chromatin binding is modulated by interactions of different LAP2? domains with lamins and chromatin iScience 2024-09-25 [PMID: 39319273] |
|
|
| JH Ahn, MG Cho, S Sohn, JH Lee Inhibition of PP2A activity by H2O2 during mitosis disrupts nuclear envelope reassembly and alters nuclear shape Exp. Mol. Med., 2019-06-05;51(6):64. 2019-06-05 [PMID: 31164634] |
|
|
| Suzuki Y, Ogawa K, Koyanagi Y, Suzuki Y. Functional Disruption of the Moloney Murine Leukemia Virus Preintegration Complex by Vaccinia-related Kinases. J Biol Chem. 2010-05-28 [PMID: 20511217] |
|
|
Reviews for BANF1 Antibody (H00008815-M07) (0)
There are no reviews for BANF1 Antibody (H00008815-M07).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for BANF1 Antibody (H00008815-M07) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional BANF1 Products
Research Areas for BANF1 Antibody (H00008815-M07)
Find related products by research area.
|
Blogs on BANF1