Recombinant Human BACH1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BACH1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-97 of Human BACH1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HLAKGFWSDICSTDTPCQMQLSPAVAKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPC

Protein/Peptide Type
Partial Recombinant Protein
Gene
BACH1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BACH1 Protein

  • BACH1
  • basic region leucine zipper transcriptional regulator BACH1
  • BTB and CNC homolog 1
  • BTB and CNC homology 1, basic leucine zipper transcription factor 1
  • BTB
  • HA2303
  • transcription regulator protein BACH1
  • transcription regulator protein10BACH-1

Background

BACH1 - BTB and CNC homology 1, basic leucine zipper transcription factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-92139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP2-14345
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
21340002
Species: Hu
Applications: ELISA
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
MAB3809
Species: Hu, Mu
Applications: WB
NB100-2564
Species: Hu
Applications: WB
NB100-56552
Species: Hu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for BACH1 Partial Recombinant Protein (H00000571-Q01) (0)

There are no publications for BACH1 Partial Recombinant Protein (H00000571-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BACH1 Partial Recombinant Protein (H00000571-Q01) (0)

There are no reviews for BACH1 Partial Recombinant Protein (H00000571-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BACH1 Partial Recombinant Protein (H00000571-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BACH1 Products

Bioinformatics Tool for BACH1 Partial Recombinant Protein (H00000571-Q01)

Discover related pathways, diseases and genes to BACH1 Partial Recombinant Protein (H00000571-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BACH1 Partial Recombinant Protein (H00000571-Q01)

Discover more about diseases related to BACH1 Partial Recombinant Protein (H00000571-Q01).
 

Pathways for BACH1 Partial Recombinant Protein (H00000571-Q01)

View related products by pathway.

PTMs for BACH1 Partial Recombinant Protein (H00000571-Q01)

Learn more about PTMs related to BACH1 Partial Recombinant Protein (H00000571-Q01).
 

Research Areas for BACH1 Partial Recombinant Protein (H00000571-Q01)

Find related products by research area.

Blogs on BACH1

There are no specific blogs for BACH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FANCD2 Antibody
NB100-182

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BACH1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BACH1
Entrez