We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human B4GALT7 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related B4GALT7 Peptides and Proteins

Order Details


    • Catalog Number
      H00011285-Q02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human B4GALT7 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 51-140 of Human B4GALT7

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LSCSGDVARAVRGQGQETSGPPRACPPEPPPEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
B4GALT7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
35.64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human B4GALT7 GST (N-Term) Protein

  • B4GalT7
  • b4Gal-T7
  • beta-1,4-galactosyltransferase 7
  • Beta-1,4-GalTase 7
  • beta4Gal-T7
  • beta4GalT-VII
  • EC 2.4.1.-
  • EDSP1
  • EDSSLA
  • EDSSPD1
  • proteoglycan UDP-galactose:beta-xylose beta1,4-galactosyltransferase I
  • UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 7
  • UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 7
  • XGALT1
  • XGALT-1
  • XGALT1beta-1,4-galactosyltransferase VII
  • XGPT
  • XGPT1
  • xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7(galactosyltransferase I)

Background

This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene attaches the first galactose in the common carbohydrate-protein (GlcA-beta1,3-Gal-beta1,3-Gal-beta1,4-Xyl-beta1-O-Ser) linkage found in proteoglycans. Manganese is required as a cofactor. This enzyme differs from the other six beta4GalTs because it lacks the conserved beta4GalT1-beta4GalT6 Cys residues and it is located in cis-Golgi instead of trans-Golgi. Two single-nucleotide mutations were identified from a patient with the progeroid type of Ehlers-Danlos syndrome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1060
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
AF2667
Species: Hu
Applications: IHC, WB
H00126792-B01P-50ug
Species: Hu
Applications: ICC/IF, WB
AF1152
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-88654
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-717
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, RIA, RI, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-80104
Species: Hu
Applications: WB
AF2918
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-83192
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB7276
Species: Ch
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-92292
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
NBP1-80641
Species: Hu
Applications: IHC,  IHC-P

Publications for B4GALT7 Partial Recombinant Protein (H00011285-Q02) (0)

There are no publications for B4GALT7 Partial Recombinant Protein (H00011285-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B4GALT7 Partial Recombinant Protein (H00011285-Q02) (0)

There are no reviews for B4GALT7 Partial Recombinant Protein (H00011285-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B4GALT7 Partial Recombinant Protein (H00011285-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional B4GALT7 Products

Blogs on B4GALT7

There are no specific blogs for B4GALT7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human B4GALT7 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol B4GALT7