Recombinant Human B3GNT3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human B3GNT3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 135-208 of Human B3GNT3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
B3GNT3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human B3GNT3 Protein

  • B3GALT8
  • B3GAL-T8
  • B3GN-T3
  • B3GNT-3
  • Beta-1,3-galactosyltransferase 8
  • Beta-1,3-GalTase 8
  • Beta-1,3-Gn-T3
  • Beta-1,3-N-acetylglucosaminyltransferase 3
  • beta-1,3-N-acetylglucosaminyltransferase bGnT-3
  • beta3GalT8
  • Beta3Gal-T8
  • beta3Gn-T3
  • beta-3-Gx-T8
  • BGnT-3
  • Core 1 extending beta-1,3-N-acetylglucosaminyltransferase
  • core1-beta3GlcNAcT
  • EC 2.4.1
  • EC 2.4.1.-
  • HP10328
  • putative type II membrane protein
  • TMEM3beta3Gal-T8
  • transmembrane protein 3
  • UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 8
  • UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 8
  • UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3

Background

B3GNT3 - UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2030
Species: Hu
Applications: WB, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP2-45527
Species: Hu
Applications: WB, IHC, IF
NB100-56536
Species: Hu
Applications: Flow, IHC, IHC-P, Flow-CS, Flow-IC
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP1-92566
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-30927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
NBP1-86921
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
AF8519
Species: Hu, Mu, Rt
Applications: WB
AF2795
Species: Hu
Applications: WB
NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS
MAB1980
Species: Hu
Applications: WB, Simple Western, IP, ICC

Publications for B3GNT3 Partial Recombinant Protein (H00010331-Q01) (0)

There are no publications for B3GNT3 Partial Recombinant Protein (H00010331-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GNT3 Partial Recombinant Protein (H00010331-Q01) (0)

There are no reviews for B3GNT3 Partial Recombinant Protein (H00010331-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B3GNT3 Partial Recombinant Protein (H00010331-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional B3GNT3 Products

Bioinformatics Tool for B3GNT3 Partial Recombinant Protein (H00010331-Q01)

Discover related pathways, diseases and genes to B3GNT3 Partial Recombinant Protein (H00010331-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B3GNT3 Partial Recombinant Protein (H00010331-Q01)

Discover more about diseases related to B3GNT3 Partial Recombinant Protein (H00010331-Q01).
 

Pathways for B3GNT3 Partial Recombinant Protein (H00010331-Q01)

View related products by pathway.

Blogs on B3GNT3

There are no specific blogs for B3GNT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

B3GNT3 Antibody
NBP1-32539

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human B3GNT3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GNT3