B3GNT3 Antibody (1A2) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: B3GNT3 Antibody (1A2) [H00010331-M01] - Analysis of monoclonal antibody to B3GNT3 on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: B3GNT3 Antibody (1A2) [H00010331-M01] - Detection limit for recombinant GST tagged B3GNT3 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA, ICC/IF
• Clone: 1A2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

B3GNT3 Antibody (1A2) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse B3GNT3 Antibody (1A2) - Azide and BSA Free (H00010331-M01) is a monoclonal antibody validated for use in ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: B3GNT3 (NP_055071, 135 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLN
• Specificity: B3GNT3 - UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 (1A2)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: B3GNT3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
• Application Notes: This product is useful for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for B3GNT3 Antibody (1A2) - Azide and BSA Free

• B3GALT8
• B3GAL-T8
• B3GNT3
• B3GN-T3
• B3GNT-3
• Beta-1,3-galactosyltransferase 8
• Beta-1,3-GalTase 8
• Beta-1,3-Gn-T3
• Beta-1,3-N-acetylglucosaminyltransferase 3
• beta-1,3-N-acetylglucosaminyltransferase bGnT-3
• beta3GalT8
• Beta3Gal-T8
• Beta3Gn-T3
• beta-3-Gx-T8
• BGnT-3
• Core 1 extending beta-1,3-N-acetylglucosaminyltransferase
• Core1-beta3GlcNAcT
• EC 2.4.1
• EC 2.4.1.-
• HP10328
• putative type II membrane protein
• TMEM3
• TMEM3beta3Gal-T8
• transmembrane protein 3
• UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 8
• UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 8
• UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3

Background

This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein and contains a signal anchor that is not cleaved. It prefers the substrates of lacto-N-tetraose and lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains and the biosynthesis of the backbone structure of dimeric sialyl Lewis a. It plays dominant roles in L-selectin ligand biosynthesis, lymphocyte homing and lymphocyte trafficking. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: B3GNT3
• Entrez:
  • 10331(Human)
• Uniprot:
  • NP_055071(Human)