AXUD1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AXUD1 Antibody [NBP2-56676] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AXUD1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FAQEQARARHEKLRQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVS
Specificity
Specificity of human AXUD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSRNP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for AXUD1 Antibody

  • AXIN1 up-regulated 1
  • Axin-1 up-regulated gene 1 protein
  • AXUD1DKFZp566F164
  • CSRNP-1
  • cysteine/serine-rich nuclear protein 1
  • cysteine-serine-rich nuclear protein 1
  • FAM130B
  • Protein URAX1
  • TAIP3
  • TAIP-3TGF-beta-induced apoptosis protein 3
  • TGF-beta induced apoptosis protein 3
  • URAX1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP1-98280
Species: Hu, Bv, Ca, Eq, Rb
Applications: WB
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
NBP1-83933
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01787
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02340
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NBP1-90660
Species: Hu
Applications: IHC, IHC-P
NBP2-56676
Species: Hu
Applications: ICC/IF

Publications for AXUD1 Antibody (NBP2-56676) (0)

There are no publications for AXUD1 Antibody (NBP2-56676).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AXUD1 Antibody (NBP2-56676) (0)

There are no reviews for AXUD1 Antibody (NBP2-56676). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AXUD1 Antibody (NBP2-56676) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AXUD1 Products

Bioinformatics Tool for AXUD1 Antibody (NBP2-56676)

Discover related pathways, diseases and genes to AXUD1 Antibody (NBP2-56676). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AXUD1 Antibody (NBP2-56676)

Discover more about diseases related to AXUD1 Antibody (NBP2-56676).
 

Pathways for AXUD1 Antibody (NBP2-56676)

View related products by pathway.

PTMs for AXUD1 Antibody (NBP2-56676)

Learn more about PTMs related to AXUD1 Antibody (NBP2-56676).
 

Research Areas for AXUD1 Antibody (NBP2-56676)

Find related products by research area.

Blogs on AXUD1

There are no specific blogs for AXUD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AXUD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSRNP1