ATXN1L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ATXN1L Antibody [NBP2-56746] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATXN1L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HPGIHYPPLHYAQLPSTSLQFIGSPYSLPYAVPPNFLPSPLLSPSANLATSHLPHFVPYASLLAEGATPP
Specificity
Specificity of human ATXN1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATXN1L
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATXN1L Recombinant Protein Antigen (NBP2-56746PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ATXN1L Antibody

  • Ankyrin Repeat And SOCS Box Containing 16
  • Ankyrin Repeat And SOCS Box-Containing 16
  • ASB-16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90065
Species: Hu
Applications: IHC, IHC-P
NBP1-33427
Species: Hu
Applications: WB, ICC/IF, ChIP
NB110-59906
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IP, KO
NB120-5802
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-27152
Species: Mu
Applications: WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84579
Species: Hu
Applications: IHC, IHC-P
NBP1-32482
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85466
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
NBP1-88220
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-67605
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-87960
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF1107
Species: Mu
Applications: WB, IHC
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for ATXN1L Antibody (NBP2-56746) (0)

There are no publications for ATXN1L Antibody (NBP2-56746).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATXN1L Antibody (NBP2-56746) (0)

There are no reviews for ATXN1L Antibody (NBP2-56746). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATXN1L Antibody (NBP2-56746) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ATXN1L Products

Bioinformatics Tool for ATXN1L Antibody (NBP2-56746)

Discover related pathways, diseases and genes to ATXN1L Antibody (NBP2-56746). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATXN1L Antibody (NBP2-56746)

Discover more about diseases related to ATXN1L Antibody (NBP2-56746).
 

Pathways for ATXN1L Antibody (NBP2-56746)

View related products by pathway.

PTMs for ATXN1L Antibody (NBP2-56746)

Learn more about PTMs related to ATXN1L Antibody (NBP2-56746).

Blogs on ATXN1L

There are no specific blogs for ATXN1L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATXN1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATXN1L