ATPase Recombinant Protein Antigen

Images

 
There are currently no images for ATPase Protein (NBP1-89709PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ATPase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAH8.

Source: E. coli

Amino Acid Sequence: ILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETEEGENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DNAH8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89709.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATPase Recombinant Protein Antigen

  • ATPase
  • axonemal
  • dynein, axonemal, heavy chain 8
  • dynein, axonemal, heavy polypeptide 8
  • FLJ25850
  • FLJ36115
  • FLJ36334
  • hdhc9

Background

CATALYTIC ACTIVITY: ATP + H2O = ADP + phosphate. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein (By similarity). ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. SIMILARITY: Belongs to the cation transport ATPase (P-type) family. Type V subfamily.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19015
Species: Hu, Mu
Applications: ELISA, ICC/IF,  IHC-P, IP, Simple Western, WB
NBP2-72022
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP2-30949
Species: Hu
Applications: IHC,  IHC-P
NBP1-97308
Species: Ca, Hu, Mu, Rt
Applications: DB, ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
AF5055
Species: Hu
Applications: WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-31366
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81734
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF1519
Species: Hu
Applications: IHC, WB
NBP2-32432
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-92041
Species: Hu
Applications: IHC,  IHC-P, WB
AF6897
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-85720
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF4499
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NBP1-89709PEP
Species: Hu
Applications: AC

Publications for ATPase Protein (NBP1-89709PEP) (0)

There are no publications for ATPase Protein (NBP1-89709PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATPase Protein (NBP1-89709PEP) (0)

There are no reviews for ATPase Protein (NBP1-89709PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATPase Protein (NBP1-89709PEP). (Showing 1 - 4 of 4 FAQ).

  1. I have phosphate in my enzyme. What can I do?
    • You can dialyse or desalt the enzyme into a phosphate-free buffer. Alternatively, you can use a special resin (PiBind) to remove the phosphate.
  2. I have 5% DMSO in my assay. Can I use PiColorLock Gold?
    • Yes, the reagent is designed for drug screening work and other situations that require DMSO.
  3. I have a high background in my ATPase assay and I definitely do not have free phosphate in my sample
    • This is almost always due to inadequate mixing of the special stabilizer with the sample and detection reagent. Make sure the stabilizer is pipetted up and down several times to ensure thorough mixing.
  4. I would like to measure the conversion of pyrophosphate to phosphate. Can I use the PiColorLock Gold Phosphate Detection System for this purpose?
    • Yes, only the phosphate will give a signal; pyrophosphate will not.

Additional ATPase Products

Research Areas for ATPase Protein (NBP1-89709PEP)

Find related products by research area.

Blogs on ATPase

There are no specific blogs for ATPase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATPase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAH8